Detailed information NTG0266931

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: C2E56_RS01105
• Genome accession: NZ_CP026084
• Coordinates: 189916..190245 (+)
• Length: 109 a.a.
• NCBI ID: WP_000793380.1
• Uniprot ID: A0A0E1EKJ1
• Organism: Streptococcus agalactiae strain NJ1606
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 184916..195245

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
C2E56_RS01090 (C2E56_01110)	-	187474..187839 (+)	366	WP_000285373.1	DUF1033 family protein	-
C2E56_RS01095 (C2E56_01120)	comYA	188011..188982 (+)	972	WP_000250799.1	competence type IV pilus ATPase ComGA	Machinery gene
C2E56_RS01100 (C2E56_01125)	comYB	188876..189919 (+)	1044	WP_228322108.1	competence type IV pilus assembly protein ComGB	Machinery gene
C2E56_RS01105 (C2E56_01130)	comGC/cglC	189916..190245 (+)	330	WP_000793380.1	competence type IV pilus major pilin ComGC	Machinery gene
C2E56_RS01110 (C2E56_01135)	comYD	190220..190633 (+)	414	WP_017646959.1	competence type IV pilus minor pilin ComGD	Machinery gene
C2E56_RS01115 (C2E56_01140)	comGE	190605..190904 (+)	300	WP_025195478.1	competence type IV pilus minor pilin ComGE	-
C2E56_RS01120 (C2E56_01145)	comGF	190858..191319 (+)	462	WP_001874060.1	competence type IV pilus minor pilin ComGF	-
C2E56_RS01125 (C2E56_01150)	comGG	191297..191668 (+)	372	WP_000601103.1	competence type IV pilus minor pilin ComGG	-
C2E56_RS01130 (C2E56_01155)	comYH	191783..192757 (+)	975	WP_001008568.1	class I SAM-dependent methyltransferase	Machinery gene
C2E56_RS01135 (C2E56_01160)	-	192789..193982 (+)	1194	WP_000047537.1	acetate kinase	-
C2E56_RS01140 (C2E56_01165)	-	194134..194340 (+)	207	WP_000798241.1	helix-turn-helix transcriptional regulator	-
C2E56_RS10810 (C2E56_01170)	-	194399..194536 (+)	138	WP_079263416.1	hypothetical protein	-
C2E56_RS01145 (C2E56_01175)	-	194639..195031 (+)	393	WP_001265365.1	hypothetical protein	-

Sequence

Protein

• Length: 109 a.a.
• Molecular weight: 12129.27 Da
• Isoelectric Point: 10.0311

>NTDB_id=266931 C2E56_RS01105 WP_000793380.1 189916..190245(+) (comGC/cglC) [Streptococcus agalactiae strain NJ1606]
MKNLLLKCKDKKVKAFTLLEMLVVLIIISVLLLLFVPNLSKQKESVTRTGNAAVVKVVESQAELFELQETGRKASLSTLK
SGGYITEKQEKAYLDYYKDSSNGSQKISS

Nucleotide

• Length: 330 bp

>NTDB_id=266931 C2E56_RS01105 WP_000793380.1 189916..190245(+) (comGC/cglC) [Streptococcus agalactiae strain NJ1606]
ATGAAAAATTTATTGTTAAAATGTAAGGATAAGAAGGTTAAAGCATTTACACTTTTAGAAATGTTAGTTGTTTTGATCAT
TATTTCGGTCTTGTTGTTATTGTTTGTACCCAATTTATCAAAACAAAAGGAAAGTGTCACAAGAACTGGAAATGCCGCTG
TTGTCAAGGTTGTAGAAAGTCAAGCCGAACTTTTTGAACTGCAAGAAACAGGTAGAAAAGCTAGTTTATCCACTCTAAAA
TCTGGAGGATATATTACTGAAAAGCAAGAAAAAGCCTATTTAGATTATTATAAAGACAGTTCCAATGGTTCTCAGAAAAT
TTCAAGTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-34)

3D structure

• AlphaFold DB: A0A0E1EKJ1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis NCTC 12261	60.55	100	0.606
comGC/cglC	Streptococcus mitis SK321	59.633	100	0.596
comYC	Streptococcus gordonii str. Challis substr. CH1	61.165	94.495	0.578
comGC/cglC	Streptococcus pneumoniae TIGR4	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae R6	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae Rx1	57.798	100	0.578
comGC/cglC	Streptococcus pneumoniae D39	57.798	100	0.578
comYC	Streptococcus mutans UA159	55.238	96.33	0.532
comYC	Streptococcus mutans UA140	55.238	96.33	0.532
comGC	Lactococcus lactis subsp. cremoris KW2	63.043	84.404	0.532
comYC	Streptococcus suis isolate S10	65.854	75.229	0.495