Detailed information
Bioinformatically predicted
Overview
| Name | comYD | Type | Machinery gene |
| Locus tag | C2E56_RS01110 | Genome accession | NZ_CP026084 |
| Coordinates | 190220..190633 (+) | Length | 137 a.a. |
| NCBI ID | WP_017646959.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae strain NJ1606 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 191491..256969 | 190220..190633 | flank | 858 |
Gene organization within MGE regions
Location: 190220..256969
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C2E56_RS01110 (C2E56_01135) | comYD | 190220..190633 (+) | 414 | WP_017646959.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| C2E56_RS01115 (C2E56_01140) | comGE | 190605..190904 (+) | 300 | WP_025195478.1 | competence type IV pilus minor pilin ComGE | - |
| C2E56_RS01120 (C2E56_01145) | comGF | 190858..191319 (+) | 462 | WP_001874060.1 | competence type IV pilus minor pilin ComGF | - |
| C2E56_RS01125 (C2E56_01150) | comGG | 191297..191668 (+) | 372 | WP_000601103.1 | competence type IV pilus minor pilin ComGG | - |
| C2E56_RS01130 (C2E56_01155) | comYH | 191783..192757 (+) | 975 | WP_001008568.1 | class I SAM-dependent methyltransferase | Machinery gene |
| C2E56_RS01135 (C2E56_01160) | - | 192789..193982 (+) | 1194 | WP_000047537.1 | acetate kinase | - |
| C2E56_RS01140 (C2E56_01165) | - | 194134..194340 (+) | 207 | WP_000798241.1 | helix-turn-helix transcriptional regulator | - |
| C2E56_RS10810 (C2E56_01170) | - | 194399..194536 (+) | 138 | WP_079263416.1 | hypothetical protein | - |
| C2E56_RS01145 (C2E56_01175) | - | 194639..195031 (+) | 393 | WP_001265365.1 | hypothetical protein | - |
| C2E56_RS01150 (C2E56_01180) | - | 195100..195765 (+) | 666 | WP_000008107.1 | CPBP family intramembrane glutamic endopeptidase | - |
| C2E56_RS01155 (C2E56_01185) | proC | 195786..196556 (-) | 771 | WP_161508486.1 | pyrroline-5-carboxylate reductase | - |
| C2E56_RS01160 (C2E56_01190) | pepA | 196626..197693 (-) | 1068 | WP_001281326.1 | glutamyl aminopeptidase | - |
| C2E56_RS01165 (C2E56_01195) | - | 197878..198117 (-) | 240 | WP_000660178.1 | hypothetical protein | - |
| C2E56_RS01170 (C2E56_01200) | - | 198278..198562 (+) | 285 | WP_000791272.1 | DUF4651 domain-containing protein | - |
| C2E56_RS01175 (C2E56_01205) | - | 198559..198882 (+) | 324 | WP_000602780.1 | thioredoxin family protein | - |
| C2E56_RS01180 (C2E56_01210) | ytpR | 198915..199541 (+) | 627 | WP_000578324.1 | YtpR family tRNA-binding protein | - |
| C2E56_RS01185 (C2E56_01215) | - | 199595..200311 (-) | 717 | WP_000186181.1 | class I SAM-dependent methyltransferase | - |
| C2E56_RS01190 (C2E56_01220) | ssbA | 200392..200787 (+) | 396 | WP_000282447.1 | single-stranded DNA-binding protein | Machinery gene |
| C2E56_RS01195 (C2E56_01225) | - | 200911..201555 (+) | 645 | WP_000416615.1 | HAD family hydrolase | - |
| C2E56_RS01200 (C2E56_01230) | - | 201582..203327 (+) | 1746 | WP_000930336.1 | LytS/YhcK type 5TM receptor domain-containing protein | - |
| C2E56_RS01205 (C2E56_01235) | - | 203308..204048 (+) | 741 | WP_000697630.1 | LytR/AlgR family response regulator transcription factor | - |
| C2E56_RS01210 (C2E56_01240) | - | 204218..204673 (+) | 456 | WP_000683316.1 | CidA/LrgA family protein | - |
| C2E56_RS01215 (C2E56_01245) | lrgB | 204675..205403 (+) | 729 | WP_000421727.1 | antiholin-like protein LrgB | - |
| C2E56_RS01220 (C2E56_01255) | - | 205645..207273 (+) | 1629 | WP_000170502.1 | ABC transporter substrate-binding protein | - |
| C2E56_RS01225 (C2E56_01260) | - | 207386..208363 (+) | 978 | WP_000680645.1 | ABC transporter permease | - |
| C2E56_RS01230 (C2E56_01265) | - | 208360..209181 (+) | 822 | WP_017646958.1 | ABC transporter permease | - |
| C2E56_RS01235 (C2E56_01270) | - | 209193..209996 (+) | 804 | WP_000140980.1 | ABC transporter ATP-binding protein | - |
| C2E56_RS01240 (C2E56_01275) | - | 209980..210606 (+) | 627 | WP_000171312.1 | ABC transporter ATP-binding protein | - |
| C2E56_RS01245 (C2E56_01280) | treP | 210889..212919 (+) | 2031 | WP_017648367.1 | PTS system trehalose-specific EIIBC component | - |
| C2E56_RS01250 (C2E56_01285) | treC | 213141..214766 (+) | 1626 | WP_000151018.1 | alpha,alpha-phosphotrehalase | - |
| C2E56_RS01255 (C2E56_01290) | - | 214982..217018 (+) | 2037 | WP_017646956.1 | BglG family transcription antiterminator | - |
| C2E56_RS01260 (C2E56_01295) | - | 217021..217305 (+) | 285 | WP_000944235.1 | PTS sugar transporter subunit IIB | - |
| C2E56_RS01265 (C2E56_01300) | - | 217318..218673 (+) | 1356 | WP_000677351.1 | PTS ascorbate transporter subunit IIC | - |
| C2E56_RS01270 (C2E56_01305) | - | 218676..219533 (+) | 858 | WP_017646955.1 | transketolase | - |
| C2E56_RS01275 (C2E56_01310) | - | 219530..220459 (+) | 930 | WP_017646954.1 | transketolase family protein | - |
| C2E56_RS01280 (C2E56_01315) | - | 220568..221827 (+) | 1260 | WP_017646953.1 | ferric reductase-like transmembrane domain-containing protein | - |
| C2E56_RS01285 (C2E56_01320) | rpsO | 221915..222184 (+) | 270 | WP_001018249.1 | 30S ribosomal protein S15 | - |
| C2E56_RS01290 (C2E56_01325) | pnp | 222565..224694 (+) | 2130 | WP_017646952.1 | polyribonucleotide nucleotidyltransferase | - |
| C2E56_RS01295 (C2E56_01330) | - | 224696..225448 (+) | 753 | WP_017646951.1 | SseB family protein | - |
| C2E56_RS01300 (C2E56_01335) | cysE | 225457..226041 (+) | 585 | WP_000539954.1 | serine O-acetyltransferase | - |
| C2E56_RS01305 (C2E56_01340) | - | 226051..226233 (+) | 183 | WP_000656476.1 | lipoprotein | - |
| C2E56_RS01310 (C2E56_01345) | cysS | 226230..227573 (+) | 1344 | WP_017648218.1 | cysteine--tRNA ligase | - |
| C2E56_RS01315 (C2E56_01350) | - | 227566..227952 (+) | 387 | WP_000568031.1 | Mini-ribonuclease 3 | - |
| C2E56_RS01320 (C2E56_01355) | rlmB | 228055..228810 (+) | 756 | WP_000178020.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| C2E56_RS01325 (C2E56_01360) | - | 228807..229325 (+) | 519 | WP_000716636.1 | NYN domain-containing protein | - |
| C2E56_RS01330 (C2E56_01365) | - | 229418..230278 (+) | 861 | WP_000143135.1 | DegV family protein | - |
| C2E56_RS01335 (C2E56_01375) | - | 230815..230934 (+) | 120 | Protein_210 | helix-turn-helix transcriptional regulator | - |
| C2E56_RS01340 (C2E56_01380) | rplM | 231159..231605 (+) | 447 | WP_001867156.1 | 50S ribosomal protein L13 | - |
| C2E56_RS01345 (C2E56_01385) | rpsI | 231626..232018 (+) | 393 | WP_000035940.1 | 30S ribosomal protein S9 | - |
| C2E56_RS01350 (C2E56_01390) | - | 232125..233342 (-) | 1218 | WP_017648214.1 | site-specific integrase | - |
| C2E56_RS01355 (C2E56_01395) | - | 233355..233621 (-) | 267 | WP_017648213.1 | helix-turn-helix transcriptional regulator | - |
| C2E56_RS01360 (C2E56_01400) | - | 233643..234746 (-) | 1104 | WP_017648212.1 | CHAP domain-containing protein | - |
| C2E56_RS01365 (C2E56_01405) | - | 234749..236650 (-) | 1902 | WP_017648211.1 | DUF4013 domain-containing protein | - |
| C2E56_RS01370 (C2E56_01410) | - | 236718..237329 (-) | 612 | WP_017648210.1 | Fic/DOC family protein | - |
| C2E56_RS01375 (C2E56_01415) | - | 237322..237510 (-) | 189 | WP_000141834.1 | hypothetical protein | - |
| C2E56_RS01380 (C2E56_01420) | - | 237559..240057 (-) | 2499 | WP_161508487.1 | ATP-binding protein | - |
| C2E56_RS01385 (C2E56_01425) | - | 240041..240457 (-) | 417 | WP_000348517.1 | TcpE family conjugal transfer membrane protein | - |
| C2E56_RS01390 (C2E56_01430) | - | 240467..240685 (-) | 219 | WP_000175077.1 | TcpD family membrane protein | - |
| C2E56_RS01395 (C2E56_01435) | - | 240682..241626 (-) | 945 | WP_017648208.1 | conjugal transfer protein | - |
| C2E56_RS01400 (C2E56_01440) | - | 241640..241903 (-) | 264 | WP_017648207.1 | hypothetical protein | - |
| C2E56_RS01405 (C2E56_01445) | - | 241913..242185 (-) | 273 | WP_017648206.1 | hypothetical protein | - |
| C2E56_RS01410 (C2E56_01450) | - | 242205..242678 (-) | 474 | WP_017648205.1 | hypothetical protein | - |
| C2E56_RS01415 (C2E56_01455) | - | 242675..242911 (-) | 237 | WP_000418738.1 | hypothetical protein | - |
| C2E56_RS01420 (C2E56_01460) | - | 242924..244153 (-) | 1230 | WP_124748704.1 | replication initiation factor domain-containing protein | - |
| C2E56_RS01425 (C2E56_01465) | - | 244390..246057 (-) | 1668 | WP_017648203.1 | FtsK/SpoIIIE domain-containing protein | - |
| C2E56_RS01430 (C2E56_01470) | - | 246054..246500 (-) | 447 | WP_017648202.1 | hypothetical protein | - |
| C2E56_RS01435 (C2E56_01475) | - | 246543..246836 (-) | 294 | WP_017648201.1 | hypothetical protein | - |
| C2E56_RS01440 (C2E56_01480) | - | 246867..247106 (-) | 240 | WP_017648200.1 | hypothetical protein | - |
| C2E56_RS01445 | - | 247229..247369 (-) | 141 | WP_153308373.1 | hypothetical protein | - |
| C2E56_RS01450 (C2E56_01485) | - | 247715..248068 (+) | 354 | WP_017648199.1 | helix-turn-helix domain-containing protein | - |
| C2E56_RS01455 (C2E56_01490) | - | 248080..248259 (+) | 180 | WP_017648198.1 | helix-turn-helix domain-containing protein | - |
| C2E56_RS10995 | - | 248269..248934 (+) | 666 | WP_017648197.1 | hypothetical protein | - |
| C2E56_RS11000 | - | 248976..249569 (+) | 594 | WP_017648196.1 | hypothetical protein | - |
| C2E56_RS01465 (C2E56_01500) | - | 249646..250512 (+) | 867 | WP_236564266.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C2E56_RS01470 (C2E56_01505) | - | 250523..251209 (+) | 687 | WP_017648194.1 | LexA family transcriptional regulator | - |
| C2E56_RS01475 (C2E56_01510) | - | 251214..252629 (+) | 1416 | WP_017648193.1 | Y-family DNA polymerase | - |
| C2E56_RS01480 (C2E56_01515) | - | 252629..253015 (+) | 387 | WP_017648192.1 | hypothetical protein | - |
| C2E56_RS01485 (C2E56_01520) | - | 252987..253292 (+) | 306 | WP_017648191.1 | DUF5960 family protein | - |
| C2E56_RS11005 (C2E56_01525) | - | 253387..255900 (+) | 2514 | WP_017648190.1 | Spaf_1101 family AAA-like ATPase | - |
| C2E56_RS11010 (C2E56_01530) | - | 256090..256263 (-) | 174 | WP_079265803.1 | FanG protein | - |
| C2E56_RS01500 (C2E56_01535) | - | 256292..256906 (+) | 615 | WP_017648189.1 | CadD family cadmium resistance transporter | - |
Sequence
Protein
Download Length: 137 a.a. Molecular weight: 15910.35 Da Isoelectric Point: 9.9787
>NTDB_id=266932 C2E56_RS01110 WP_017646959.1 190220..190633(+) (comYD) [Streptococcus agalactiae strain NJ1606]
MVLRKFQVKAFTVLESLIALSVVAFMTLVFSTSFNNIFRQVEETIFFISFEHLYRDTQKLSAFGQKKQTLTISHNYLENT
YERLYLPKTVKVVKSDTLAFDANGGNSSLAKIQFECYRKTVTYQLYIGSGNYRKKEN
MVLRKFQVKAFTVLESLIALSVVAFMTLVFSTSFNNIFRQVEETIFFISFEHLYRDTQKLSAFGQKKQTLTISHNYLENT
YERLYLPKTVKVVKSDTLAFDANGGNSSLAKIQFECYRKTVTYQLYIGSGNYRKKEN
Nucleotide
Download Length: 414 bp
>NTDB_id=266932 C2E56_RS01110 WP_017646959.1 190220..190633(+) (comYD) [Streptococcus agalactiae strain NJ1606]
ATGGTTCTCAGAAAATTTCAAGTTAAAGCATTTACTGTTTTGGAGAGCCTTATTGCATTATCAGTAGTGGCATTTATGAC
GTTAGTATTTTCAACATCATTTAATAATATTTTTAGGCAGGTTGAAGAAACAATTTTCTTCATATCCTTTGAACATCTTT
ATAGAGATACTCAGAAATTGAGTGCATTTGGTCAGAAGAAACAAACCCTTACAATCTCTCATAATTATCTCGAAAATACT
TATGAGAGACTTTATTTACCTAAAACTGTAAAAGTAGTCAAAAGTGACACACTTGCATTTGACGCTAATGGAGGGAATTC
AAGCTTGGCAAAAATTCAATTTGAATGTTATAGAAAAACTGTCACGTATCAATTATATATAGGAAGTGGTAACTATCGTA
AGAAAGAAAATTAG
ATGGTTCTCAGAAAATTTCAAGTTAAAGCATTTACTGTTTTGGAGAGCCTTATTGCATTATCAGTAGTGGCATTTATGAC
GTTAGTATTTTCAACATCATTTAATAATATTTTTAGGCAGGTTGAAGAAACAATTTTCTTCATATCCTTTGAACATCTTT
ATAGAGATACTCAGAAATTGAGTGCATTTGGTCAGAAGAAACAAACCCTTACAATCTCTCATAATTATCTCGAAAATACT
TATGAGAGACTTTATTTACCTAAAACTGTAAAAGTAGTCAAAAGTGACACACTTGCATTTGACGCTAATGGAGGGAATTC
AAGCTTGGCAAAAATTCAATTTGAATGTTATAGAAAAACTGTCACGTATCAATTATATATAGGAAGTGGTAACTATCGTA
AGAAAGAAAATTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYD | Streptococcus mutans UA140 |
51.515 |
96.35 |
0.496 |
| comYD | Streptococcus mutans UA159 |
51.515 |
96.35 |
0.496 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
46.667 |
98.54 |
0.46 |
| comGD/cglD | Streptococcus mitis NCTC 12261 |
40.299 |
97.81 |
0.394 |
| comGD/cglD | Streptococcus pneumoniae TIGR4 |
42.52 |
92.701 |
0.394 |
| comGD/cglD | Streptococcus mitis SK321 |
42.52 |
92.701 |
0.394 |
| comGD/cglD | Streptococcus pneumoniae Rx1 |
41.732 |
92.701 |
0.387 |
| comGD/cglD | Streptococcus pneumoniae D39 |
41.732 |
92.701 |
0.387 |
| comGD/cglD | Streptococcus pneumoniae R6 |
41.732 |
92.701 |
0.387 |