Detailed information NTG0246596

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: CMV25_RS04335
• Genome accession: NZ_CP023392
• Coordinates: 873836..874156 (-)
• Length: 106 a.a.
• NCBI ID: WP_061774318.1
• Uniprot ID: A0A290PY35
• Organism: Lactococcus raffinolactis strain WiKim0068
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 868836..879156

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CMV25_RS04295 (CMV25_04295)	-	869362..870132 (-)	771	WP_244165990.1	metal ABC transporter ATP-binding protein	-
CMV25_RS04300 (CMV25_04300)	-	870132..870581 (-)	450	WP_096039675.1	zinc-dependent MarR family transcriptional regulator	-
CMV25_RS04305 (CMV25_04305)	-	870657..871505 (-)	849	WP_096039676.1	aminotransferase class IV	-
CMV25_RS04310 (CMV25_04310)	ispE	871589..872440 (-)	852	WP_061774322.1	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	-
CMV25_RS04315 (CMV25_04315)	comGG	872445..872729 (-)	285	WP_096039677.1	competence type IV pilus minor pilin ComGG	-
CMV25_RS04320 (CMV25_04320)	comGF	872741..873184 (-)	444	WP_244165991.1	competence type IV pilus minor pilin ComGF	-
CMV25_RS04325 (CMV25_04325)	comGE	873159..873464 (-)	306	WP_082785376.1	competence type IV pilus minor pilin ComGE	-
CMV25_RS11735 (CMV25_04330)	comGD	873436..873921 (-)	486	WP_341865229.1	competence type IV pilus minor pilin ComGD	-
CMV25_RS04335 (CMV25_04335)	comYC	873836..874156 (-)	321	WP_061774318.1	competence type IV pilus major pilin ComGC	Machinery gene
CMV25_RS04340 (CMV25_04340)	comYB	874165..875250 (-)	1086	WP_310592697.1	competence type IV pilus assembly protein ComGB	Machinery gene
CMV25_RS04345 (CMV25_04345)	comGA/cglA/cilD	875132..876073 (-)	942	WP_061774317.1	competence type IV pilus ATPase ComGA	Machinery gene
CMV25_RS04350 (CMV25_04350)	-	876136..877980 (-)	1845	WP_096039681.1	acyltransferase family protein	-
CMV25_RS04355 (CMV25_04355)	-	877977..878339 (-)	363	WP_096039682.1	hypothetical protein	-

Sequence

Protein

• Length: 106 a.a.
• Molecular weight: 11969.96 Da
• Isoelectric Point: 9.8991

>NTDB_id=246596 CMV25_RS04335 WP_061774318.1 873836..874156(-) (comYC) [Lactococcus raffinolactis strain WiKim0068]
MKKEDMKKKIVRAFTLVEMLVVLLVISVLILLFIPNLSKQKETVKNTGNGAVVKVVNSQAELYRLDHTDDVTLGKLVSNG
NITQKQADAYNEYYKKNTTESREIPS

Nucleotide

• Length: 321 bp

>NTDB_id=246596 CMV25_RS04335 WP_061774318.1 873836..874156(-) (comYC) [Lactococcus raffinolactis strain WiKim0068]
CTGAAGAAAGAAGATATGAAGAAAAAAATAGTACGTGCTTTTACTTTAGTAGAAATGCTAGTTGTTCTTCTTGTCATTAG
TGTCTTAATTTTATTGTTTATCCCCAATCTATCCAAACAAAAAGAGACTGTTAAGAATACAGGAAACGGCGCTGTTGTAA
AGGTAGTTAACTCGCAAGCGGAACTTTATAGATTAGACCATACTGATGATGTTACCTTAGGCAAGCTAGTCAGCAATGGC
AATATCACACAAAAACAGGCGGATGCTTATAATGAGTACTATAAGAAGAACACAACAGAATCACGTGAAATTCCAAGCTA
G

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-32)

3D structure

• AlphaFold DB: A0A290PY35

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	66.337	95.283	0.632
comYC	Streptococcus mutans UA159	61.538	98.113	0.604
comYC	Streptococcus mutans UA140	61.538	98.113	0.604
comGC/cglC	Streptococcus mitis SK321	63.636	93.396	0.594
comGC/cglC	Streptococcus mitis NCTC 12261	62.887	91.509	0.575
comGC/cglC	Streptococcus pneumoniae R6	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae D39	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae TIGR4	60.606	93.396	0.566
comGC/cglC	Streptococcus pneumoniae Rx1	60.606	93.396	0.566
comGC	Lactococcus lactis subsp. cremoris KW2	59.783	86.792	0.519
comYC	Streptococcus suis isolate S10	57.5	75.472	0.434