Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | CGQ03_RS07745 | Genome accession | NZ_CP022905 |
| Coordinates | 1460421..1460732 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 628 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1455421..1465732
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CGQ03_RS07715 | - | 1456204..1456407 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| CGQ03_RS07720 (CGQ03_01380) | - | 1456404..1457390 (+) | 987 | WP_000161309.1 | ROK family glucokinase | - |
| CGQ03_RS07725 (CGQ03_01381) | - | 1457390..1457719 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| CGQ03_RS07730 (CGQ03_01382) | - | 1457716..1458339 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| CGQ03_RS07735 (CGQ03_01383) | comGA | 1458391..1459365 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| CGQ03_RS07740 (CGQ03_01384) | comGB | 1459337..1460407 (+) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| CGQ03_RS07745 (CGQ03_01385) | comGC | 1460421..1460732 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| CGQ03_RS07750 (CGQ03_01386) | comGD | 1460710..1461156 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| CGQ03_RS07755 (CGQ03_01387) | comGE | 1461143..1461442 (+) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| CGQ03_RS07760 (CGQ03_01388) | comGF | 1461360..1461857 (+) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| CGQ03_RS07765 | - | 1461954..1462100 (+) | 147 | WP_001792109.1 | hypothetical protein | - |
| CGQ03_RS07770 (CGQ03_01389) | - | 1462090..1462614 (+) | 525 | WP_001015120.1 | shikimate kinase | - |
| CGQ03_RS07775 (CGQ03_01390) | gcvT | 1462773..1463864 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| CGQ03_RS07780 (CGQ03_01391) | gcvPA | 1463884..1465230 (+) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=243244 CGQ03_RS07745 WP_000472256.1 1460421..1460732(+) (comGC) [Staphylococcus aureus strain 628]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=243244 CGQ03_RS07745 WP_000472256.1 1460421..1460732(+) (comGC) [Staphylococcus aureus strain 628]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |