Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | B9T46_RS09460 | Genome accession | NZ_CP020960 |
| Coordinates | 1800233..1800544 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain JK3137 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1795233..1805544
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B9T46_RS09425 (B9T46_09425) | gcvPA | 1795735..1797081 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| B9T46_RS09430 (B9T46_09430) | gcvT | 1797101..1798192 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| B9T46_RS09435 (B9T46_09435) | - | 1798351..1798875 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| B9T46_RS09440 (B9T46_09440) | - | 1798865..1799011 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| B9T46_RS09445 (B9T46_09445) | comGF | 1799108..1799605 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| B9T46_RS09450 (B9T46_09450) | comGE | 1799523..1799822 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| B9T46_RS09455 (B9T46_09455) | comGD | 1799809..1800255 (-) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| B9T46_RS09460 (B9T46_09460) | comGC | 1800233..1800544 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| B9T46_RS09465 (B9T46_09465) | comGB | 1800558..1801628 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| B9T46_RS09470 (B9T46_09470) | comGA | 1801600..1802574 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| B9T46_RS09475 (B9T46_09475) | - | 1802626..1803249 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| B9T46_RS09480 (B9T46_09480) | - | 1803246..1803574 (-) | 329 | Protein_1790 | MTH1187 family thiamine-binding protein | - |
| B9T46_RS09485 (B9T46_09485) | - | 1803574..1804560 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| B9T46_RS09490 (B9T46_09490) | - | 1804557..1804760 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=227504 B9T46_RS09460 WP_000472256.1 1800233..1800544(-) (comGC) [Staphylococcus aureus strain JK3137]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=227504 B9T46_RS09460 WP_000472256.1 1800233..1800544(-) (comGC) [Staphylococcus aureus strain JK3137]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |