Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | BWR56_RS00030 | Genome accession | NZ_CP019562 |
| Coordinates | 4538..4663 (+) | Length | 41 a.a. |
| NCBI ID | WP_008282505.1 | Uniprot ID | A0A139Q4L7 |
| Organism | Streptococcus oralis strain S.MIT/ORALIS-351 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1..9663
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWR56_RS00005 (BWR56_0001) | dnaA | 1..1362 (-) | 1362 | WP_061421574.1 | chromosomal replication initiator protein DnaA | - |
| BWR56_RS00010 (BWR56_0002) | spo0J | 1579..2337 (-) | 759 | WP_049505012.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| BWR56_RS00015 (BWR56_0003) | htrA | 2395..3591 (-) | 1197 | WP_049505014.1 | S1C family serine protease | Regulator |
| BWR56_RS00020 (BWR56_0004) | rlmH | 3777..4256 (+) | 480 | WP_049505015.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| BWR56_RS00030 (BWR56_0006) | comC/comC1 | 4538..4663 (+) | 126 | WP_008282505.1 | competence-stimulating peptide ComC | Regulator |
| BWR56_RS00035 (BWR56_0007) | comD | 4684..6003 (+) | 1320 | WP_049505018.1 | competence system sensor histidine kinase ComD | Regulator |
| BWR56_RS00040 (BWR56_0008) | comE | 6000..6752 (+) | 753 | WP_000866079.1 | competence system response regulator transcription factor ComE | Regulator |
| BWR56_RS00055 (BWR56_0011) | - | 6990..7532 (-) | 543 | WP_049477913.1 | TetR/AcrR family transcriptional regulator | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4957.73 Da Isoelectric Point: 10.2767
>NTDB_id=216287 BWR56_RS00030 WP_008282505.1 4538..4663(+) (comC/comC1) [Streptococcus oralis strain S.MIT/ORALIS-351]
MKNTVKLEQFKEVTEAELQEIRGGDKRLPYFFKHLFSNRTK
MKNTVKLEQFKEVTEAELQEIRGGDKRLPYFFKHLFSNRTK
Nucleotide
Download Length: 126 bp
>NTDB_id=216287 BWR56_RS00030 WP_008282505.1 4538..4663(+) (comC/comC1) [Streptococcus oralis strain S.MIT/ORALIS-351]
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATAAAAG
ACTACCTTACTTTTTTAAACATCTTTTTTCAAATAGGACAAAGTAG
ATGAAAAATACAGTAAAGTTGGAACAATTTAAAGAAGTAACAGAGGCAGAATTGCAGGAGATTCGAGGTGGAGATAAAAG
ACTACCTTACTTTTTTAAACATCTTTTTTCAAATAGGACAAAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus pneumoniae R6 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae G54 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae D39 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis SK321 |
68.966 |
70.732 |
0.488 |
| comC/comC2 | Streptococcus pneumoniae A66 |
58.621 |
70.732 |
0.415 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
58.621 |
70.732 |
0.415 |
| comC | Streptococcus mitis NCTC 12261 |
55.556 |
65.854 |
0.366 |
| comC/blpC | Streptococcus mutans UA159 |
44.118 |
82.927 |
0.366 |