Detailed information NTG0020187

Bioinformatically predicted

Overview

• Name: clpP
• Type: Regulator
• Locus tag: SPG_0678
• Genome accession: CP001015
• Coordinates: 662013..662144 (+)
• Length: 43 a.a.
• NCBI ID: ACF55790.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae G54
• Function: degradation of ComX; degradation of ComW (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	660194..671897	662013..662144	within	0

Gene organization within MGE regions

Location: 660194..671897

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SPG_0675	-	660194..660661 (+)	468	ACF56365.1	cytidine and deoxycytidylate deaminase family protein	-
SPG_0676	upp	660729..661379 (+)	651	ACF56075.1	uracil phosphoribosyltransferase	-
SPG_0677	clpP	661553..661996 (+)	444	ACF56558.1	ATP-dependent Clp protease proteolytic subunit	Regulator
SPG_0678	clpP	662013..662144 (+)	132	ACF55790.1	ATP-dependent Clp protease proteolytic subunit	Regulator
SPG_0679	-	662223..662471 (+)	249	ACF55168.1	hypothetical protein	-
SPG_0680	livJ	662572..663732 (+)	1161	ACF56703.1	ABC-type branched-chain amino acid transport systems, periplasmic component	-
SPG_0681	livH	664000..664869 (+)	870	ACF55977.1	branched-chain amino acid ABC transporter, permease protein	-
SPG_0682	livM	664873..665829 (+)	957	ACF55527.1	branched-chain amino acid ABC transporter, permease protein	-
SPG_0683	livG	665829..666593 (+)	765	ACF54774.1	branched-chain amino acid ABC transporter, ATP-binding protein	-
SPG_0684	livF	666593..667303 (+)	711	ACF55963.1	branched-chain amino acid ABC transporter, ATP-binding protein	-
SPG_0685	-	667611..668267 (+)	657	ACF56359.1	acetoin utilization protein AcuB, putative	-
SPG_0686	-	668481..669470 (+)	990	ACF55623.1	peptide chain release factor 2	-
SPG_0687	ftsE	669488..670180 (+)	693	ACF55126.1	cell division ATP-binding protein FtsE	-
SPG_0688	-	670173..671099 (+)	927	ACF55211.1	Cell division protein FtsX	-
SPG_0689	-	671385..671897 (+)	513	ACF56757.1	PTS system, IIBCA components	-

Sequence

Protein

• Length: 43 a.a.
• Molecular weight: 4940.11 Da
• Isoelectric Point: 3.8099

>NTDB_id=20187 SPG_0678 ACF55790.1 662013..662144(+) (clpP) [Streptococcus pneumoniae G54]
MAENSXQSMEKVHADAERDNWMSAQETLEYGFIDEIMANNSLN

Nucleotide

• Length: 132 bp

>NTDB_id=20187 SPG_0678 ACF55790.1 662013..662144(+) (clpP) [Streptococcus pneumoniae G54]
TTGGCTGAAAATTCAGNTCAGTCAATGGAAAAAGTCCATGCAGATGCAGAACGTGATAACTGGATGAGCGCCCAGGAAAC
ACTNGAATATGGCTTTATTGATGAAATTATGGCCAACAATTCATTGAACTAA

Domains

Predicted by InterproScan.

• Clp protease (CLP_protease) (1-39)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
clpP	Streptococcus pneumoniae Rx1	95.349	100	0.953
clpP	Streptococcus pneumoniae D39	95.349	100	0.953
clpP	Streptococcus pneumoniae R6	95.349	100	0.953
clpP	Streptococcus pneumoniae TIGR4	95.349	100	0.953
clpP	Streptococcus thermophilus LMG 18311	80.952	97.674	0.791
clpP	Streptococcus thermophilus LMD-9	80.952	97.674	0.791
clpP	Lactococcus lactis subsp. cremoris KW2	69.767	100	0.698
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	69.767	100	0.698
clpP	Streptococcus pyogenes JRS4	60.465	100	0.605
clpP	Streptococcus pyogenes MGAS315	60.465	100	0.605
clpP	Streptococcus mutans UA159	58.14	100	0.581
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	48.649	86.047	0.419
clpP	Bacillus subtilis subsp. subtilis str. 168	45	93.023	0.419