Detailed information NTG0183400

Bioinformatically predicted

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: LLJM4_RS02005
• Genome accession: NZ_CP015909
• Coordinates: 407725..408114 (+)
• Length: 129 a.a.
• NCBI ID: WP_021165898.1
• Uniprot ID: A0A166Z4Y5
• Organism: Lactococcus cremoris strain JM4
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	409101..417421	407725..408114	flank	987

Gene organization within MGE regions

Location: 407725..417421

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLJM4_RS02005 (LLJM4_0391)	ssbB	407725..408114 (+)	390	WP_021165898.1	single-stranded DNA-binding protein	Machinery gene
LLJM4_RS02010 (LLJM4_0392)	groES	408233..408517 (+)	285	WP_011675464.1	co-chaperone GroES	-
LLJM4_RS02015 (LLJM4_0393)	groL	408604..410232 (+)	1629	WP_021213999.1	chaperonin GroEL	-
LLJM4_RS02020 (LLJM4_0394)	-	410284..411096 (-)	813	WP_311095651.1	MBL fold metallo-hydrolase	-
LLJM4_RS02025 (LLJM4_0395)	-	411286..412713 (-)	1428	WP_134047241.1	cell wall metabolism sensor histidine kinase WalK	-
LLJM4_RS02030 (LLJM4_0396)	yycF	412706..413407 (-)	702	WP_003131580.1	response regulator YycF	-
LLJM4_RS02035 (LLJM4_0397)	tmk	413585..414220 (+)	636	WP_015082045.1	dTMP kinase	-
LLJM4_RS02040 (LLJM4_0398)	-	414353..415213 (+)	861	WP_011675470.1	DNA polymerase III subunit delta'	-
LLJM4_RS02045 (LLJM4_0399)	ricT	415263..416045 (+)	783	WP_011834464.1	stage 0 sporulation family protein	-
LLJM4_RS02050 (LLJM4_0400)	yabA	416038..416364 (+)	327	WP_011675472.1	DNA replication initiation control protein YabA	-
LLJM4_RS02055 (LLJM4_0401)	rsmI	416364..417239 (+)	876	WP_011834466.1	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	-

Sequence

Protein

• Length: 129 a.a.
• Molecular weight: 14703.77 Da
• Isoelectric Point: 6.9865

>NTDB_id=183400 LLJM4_RS02005 WP_021165898.1 407725..408114(+) (ssbB) [Lactococcus cremoris strain JM4]
MNKTMLIGRLTNAPEISKTTNNKSYVRVTLAVNRRFKNEKGEREADFISIILWGKSAETFVSYAKKGSLISVEGEIRTRN
YTDKNEQKHCITEILGLSYDLLESRATLALRESAVNFEELLLEADELPF

Nucleotide

• Length: 390 bp

>NTDB_id=183400 LLJM4_RS02005 WP_021165898.1 407725..408114(+) (ssbB) [Lactococcus cremoris strain JM4]
ATGAATAAAACCATGTTGATTGGTCGTTTAACAAACGCACCTGAAATTTCGAAAACAACGAACAATAAATCTTATGTCCG
TGTGACTCTGGCAGTCAATCGCCGCTTCAAAAATGAAAAAGGAGAGCGAGAAGCAGACTTTATCTCGATAATTTTATGGG
GAAAATCAGCAGAAACATTCGTTTCCTATGCTAAAAAAGGAAGTCTTATTTCTGTAGAGGGAGAGATTAGAACTAGAAAT
TATACTGATAAAAATGAACAGAAACACTGTATTACAGAAATCTTAGGTTTGAGCTATGATTTATTGGAAAGTCGTGCGAC
TCTTGCCTTGAGAGAAAGCGCTGTAAATTTTGAGGAACTCTTACTTGAAGCTGATGAGCTCCCTTTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (1-95)

3D structure

• AlphaFold DB: A0A166Z4Y5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB	Lactococcus lactis subsp. cremoris KW2	96.899	100	0.969
ssbB	Streptococcus sobrinus strain NIDR 6715-7	60	100	0.605
ssbA	Streptococcus mutans UA159	56.154	100	0.566
ssbB/cilA	Streptococcus pneumoniae TIGR4	56.154	100	0.566
ssbB/cilA	Streptococcus mitis SK321	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae R6	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae Rx1	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae D39	55.385	100	0.558
ssbB/cilA	Streptococcus mitis NCTC 12261	55.385	100	0.558
ssb	Latilactobacillus sakei subsp. sakei 23K	41.964	86.822	0.364