Detailed information NTG0182966

Bioinformatically predicted

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: LLJM2_RS02190
• Genome accession: NZ_CP015900
• Coordinates: 436623..437012 (+)
• Length: 129 a.a.
• NCBI ID: WP_021165898.1
• Uniprot ID: A0A166Z4Y5
• Organism: Lactococcus cremoris strain JM2
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	436618..448227	436623..437012	within	0

Gene organization within MGE regions

Location: 436618..448227

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLJM2_RS02190 (LLJM2_0423)	ssbB	436623..437012 (+)	390	WP_021165898.1	single-stranded DNA-binding protein	Machinery gene
LLJM2_RS02195 (LLJM2_0424)	groES	437131..437415 (+)	285	WP_011675464.1	co-chaperone GroES	-
LLJM2_RS02200 (LLJM2_0425)	groL	437502..439130 (+)	1629	WP_021213999.1	chaperonin GroEL	-
LLJM2_RS02205 (LLJM2_0426)	-	439182..439994 (-)	813	WP_011675466.1	MBL fold metallo-hydrolase	-
LLJM2_RS02210 (LLJM2_0427)	-	440184..441611 (-)	1428	WP_011675468.1	cell wall metabolism sensor histidine kinase WalK	-
LLJM2_RS02215 (LLJM2_0428)	yycF	441604..442305 (-)	702	WP_003131580.1	response regulator YycF	-
LLJM2_RS02220 (LLJM2_0429)	tmk	442483..443118 (+)	636	WP_015082045.1	dTMP kinase	-
LLJM2_RS02225 (LLJM2_0430)	-	443251..444111 (+)	861	WP_011675470.1	DNA polymerase III subunit delta'	-
LLJM2_RS02230 (LLJM2_0431)	ricT	444161..444943 (+)	783	WP_011834464.1	stage 0 sporulation family protein	-
LLJM2_RS02235 (LLJM2_0432)	yabA	444936..445262 (+)	327	WP_011675472.1	DNA replication initiation control protein YabA	-
LLJM2_RS02240 (LLJM2_0433)	rsmI	445262..446137 (+)	876	WP_011834466.1	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	-
LLJM2_RS02245 (LLJM2_0434)	-	446215..446406 (-)	192	WP_011675474.1	hypothetical protein	-
LLJM2_RS02250 (LLJM2_0435)	-	446481..447290 (-)	810	WP_014572051.1	ABC transporter permease	-

Sequence

Protein

• Length: 129 a.a.
• Molecular weight: 14703.77 Da
• Isoelectric Point: 6.9865

>NTDB_id=182966 LLJM2_RS02190 WP_021165898.1 436623..437012(+) (ssbB) [Lactococcus cremoris strain JM2]
MNKTMLIGRLTNAPEISKTTNNKSYVRVTLAVNRRFKNEKGEREADFISIILWGKSAETFVSYAKKGSLISVEGEIRTRN
YTDKNEQKHCITEILGLSYDLLESRATLALRESAVNFEELLLEADELPF

Nucleotide

• Length: 390 bp

>NTDB_id=182966 LLJM2_RS02190 WP_021165898.1 436623..437012(+) (ssbB) [Lactococcus cremoris strain JM2]
ATGAATAAAACCATGTTGATTGGTCGTTTAACAAACGCACCTGAAATTTCGAAAACAACGAACAATAAATCTTATGTCCG
TGTGACTCTGGCAGTCAATCGCCGCTTCAAAAATGAAAAAGGAGAGCGAGAAGCAGACTTTATCTCGATAATTTTATGGG
GAAAATCAGCAGAAACATTCGTTTCCTATGCTAAAAAAGGAAGTCTTATTTCTGTAGAGGGAGAGATTAGAACTAGAAAT
TATACTGATAAAAATGAACAGAAACACTGTATTACAGAAATCTTAGGTTTGAGCTATGATTTATTGGAAAGTCGTGCGAC
TCTTGCCTTGAGAGAAAGCGCTGTAAATTTTGAGGAACTCTTACTTGAAGCTGATGAGCTCCCTTTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (1-95)

3D structure

• AlphaFold DB: A0A166Z4Y5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB	Lactococcus lactis subsp. cremoris KW2	96.899	100	0.969
ssbB	Streptococcus sobrinus strain NIDR 6715-7	60	100	0.605
ssbA	Streptococcus mutans UA159	56.154	100	0.566
ssbB/cilA	Streptococcus pneumoniae TIGR4	56.154	100	0.566
ssbB/cilA	Streptococcus mitis SK321	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae R6	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae Rx1	55.385	100	0.558
ssbB/cilA	Streptococcus pneumoniae D39	55.385	100	0.558
ssbB/cilA	Streptococcus mitis NCTC 12261	55.385	100	0.558
ssb	Latilactobacillus sakei subsp. sakei 23K	41.964	86.822	0.364