Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | FORC39_RS07025 | Genome accession | NZ_CP015817 |
| Coordinates | 1336794..1337105 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain FORC_039 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1331794..1342105
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FORC39_RS06995 | - | 1332577..1332780 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| FORC39_RS07000 (FORC39_1215) | - | 1332777..1333763 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| FORC39_RS07005 (FORC39_1216) | - | 1333763..1334092 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| FORC39_RS07010 (FORC39_1217) | - | 1334089..1334712 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| FORC39_RS07015 (FORC39_1218) | comGA | 1334764..1335738 (+) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| FORC39_RS07020 (FORC39_1219) | comGB | 1335710..1336780 (+) | 1071 | WP_086353418.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| FORC39_RS07025 (FORC39_1220) | comGC | 1336794..1337105 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| FORC39_RS07030 (FORC39_1221) | comGD | 1337083..1337529 (+) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| FORC39_RS07035 (FORC39_1222) | comGE | 1337516..1337815 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| FORC39_RS07040 (FORC39_1223) | comGF | 1337733..1338230 (+) | 498 | WP_029642894.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| FORC39_RS07045 | - | 1338327..1338473 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| FORC39_RS07050 (FORC39_1224) | - | 1338463..1338987 (+) | 525 | WP_001015119.1 | shikimate kinase | - |
| FORC39_RS07055 (FORC39_1225) | gcvT | 1339146..1340237 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| FORC39_RS07060 (FORC39_1226) | gcvPA | 1340257..1341603 (+) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=182257 FORC39_RS07025 WP_000472256.1 1336794..1337105(+) (comGC) [Staphylococcus aureus strain FORC_039]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=182257 FORC39_RS07025 WP_000472256.1 1336794..1337105(+) (comGC) [Staphylococcus aureus strain FORC_039]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |