Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | AYM35_RS08805 | Genome accession | NZ_CP014438 |
| Coordinates | 1697690..1698001 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain USA300-SUR22 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1692690..1703001
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM35_RS08770 (AYM35_08530) | gcvPA | 1693192..1694538 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| AYM35_RS08775 (AYM35_08535) | gcvT | 1694558..1695649 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AYM35_RS08780 (AYM35_08540) | - | 1695808..1696332 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| AYM35_RS08785 (AYM35_08545) | - | 1696322..1696468 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| AYM35_RS08790 (AYM35_08550) | comGF | 1696565..1697062 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| AYM35_RS08795 (AYM35_08555) | comGE | 1696980..1697279 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| AYM35_RS08800 (AYM35_08560) | comGD | 1697266..1697712 (-) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AYM35_RS08805 (AYM35_08565) | comGC | 1697690..1698001 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| AYM35_RS08810 (AYM35_08570) | comGB | 1698015..1699085 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| AYM35_RS08815 (AYM35_08575) | comGA | 1699057..1700031 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| AYM35_RS08820 (AYM35_08580) | - | 1700083..1700706 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| AYM35_RS08825 (AYM35_08585) | - | 1700703..1701032 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| AYM35_RS08830 (AYM35_08590) | - | 1701032..1702018 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| AYM35_RS08835 (AYM35_08595) | - | 1702015..1702218 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=171571 AYM35_RS08805 WP_000472256.1 1697690..1698001(-) (comGC) [Staphylococcus aureus strain USA300-SUR22]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=171571 AYM35_RS08805 WP_000472256.1 1697690..1698001(-) (comGC) [Staphylococcus aureus strain USA300-SUR22]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |