Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | AYM15_RS08795 | Genome accession | NZ_CP014368 |
| Coordinates | 1701960..1702271 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain USA300-SUR3 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1696960..1707271
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM15_RS08760 (AYM15_08555) | gcvPA | 1697462..1698808 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| AYM15_RS08765 (AYM15_08560) | gcvT | 1698828..1699919 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AYM15_RS08770 (AYM15_08565) | - | 1700078..1700602 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| AYM15_RS08775 (AYM15_08570) | - | 1700592..1700738 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| AYM15_RS08780 (AYM15_08575) | comGF | 1700835..1701332 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| AYM15_RS08785 (AYM15_08580) | comGE | 1701250..1701549 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| AYM15_RS08790 (AYM15_08585) | comGD | 1701536..1701982 (-) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AYM15_RS08795 (AYM15_08590) | comGC | 1701960..1702271 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| AYM15_RS08800 (AYM15_08595) | comGB | 1702285..1703355 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| AYM15_RS08805 (AYM15_08600) | comGA | 1703327..1704301 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| AYM15_RS08810 (AYM15_08605) | - | 1704353..1704976 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| AYM15_RS08815 (AYM15_08610) | - | 1704973..1705302 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| AYM15_RS08820 (AYM15_08615) | - | 1705302..1706288 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| AYM15_RS08825 (AYM15_08620) | - | 1706285..1706488 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=170776 AYM15_RS08795 WP_000472256.1 1701960..1702271(-) (comGC) [Staphylococcus aureus strain USA300-SUR3]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=170776 AYM15_RS08795 WP_000472256.1 1701960..1702271(-) (comGC) [Staphylococcus aureus strain USA300-SUR3]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |