Detailed information NTG0166117

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: AWC37_RS05660
• Genome accession: NZ_CP013922
• Coordinates: 1159409..1159726 (-)
• Length: 105 a.a.
• NCBI ID: WP_029377192.1
• Uniprot ID: -
• Organism: Staphylococcus xylosus strain S170
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1154409..1164726

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AWC37_RS05625 (AWC37_05570)	gcvPA	1154955..1156307 (-)	1353	WP_058625683.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
AWC37_RS05630 (AWC37_05575)	gcvT	1156325..1157416 (-)	1092	WP_058625684.1	glycine cleavage system aminomethyltransferase GcvT	-
AWC37_RS05635 (AWC37_05580)	-	1157604..1158104 (-)	501	WP_037557022.1	shikimate kinase	-
AWC37_RS05645 (AWC37_05590)	comGF	1158284..1158715 (-)	432	WP_231291662.1	competence type IV pilus minor pilin ComGF	-
AWC37_RS05650 (AWC37_05595)	-	1158699..1158998 (-)	300	WP_029377194.1	hypothetical protein	-
AWC37_RS05655 (AWC37_05600)	comGD	1158985..1159431 (-)	447	WP_038679684.1	competence type IV pilus minor pilin ComGD	-
AWC37_RS05660 (AWC37_05605)	comGC	1159409..1159726 (-)	318	WP_029377192.1	competence type IV pilus major pilin ComGC	Machinery gene
AWC37_RS05665 (AWC37_05610)	comGB	1159746..1160813 (-)	1068	WP_051664335.1	competence type IV pilus assembly protein ComGB	-
AWC37_RS05670 (AWC37_05615)	comGA	1160785..1161759 (-)	975	WP_038678556.1	competence type IV pilus ATPase ComGA	Machinery gene
AWC37_RS05675 (AWC37_05620)	-	1161858..1162481 (-)	624	WP_029377189.1	MBL fold metallo-hydrolase	-
AWC37_RS05680 (AWC37_05625)	-	1162483..1162806 (-)	324	WP_029377188.1	MTH1187 family thiamine-binding protein	-
AWC37_RS05685 (AWC37_05630)	-	1162806..1163792 (-)	987	WP_029377187.1	glucokinase	-
AWC37_RS05690 (AWC37_05635)	-	1164174..1164371 (-)	198	WP_029377186.1	YqgQ family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11788.86 Da
• Isoelectric Point: 8.4952

>NTDB_id=166117 AWC37_RS05660 WP_029377192.1 1159409..1159726(-) (comGC) [Staphylococcus xylosus strain S170]
MNNFKNKFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQTTSCEAQLKMVDSQIEAYSLKFNKKPTTMDELVNEG
YIKENQKQCKSGALISINDGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=166117 AWC37_RS05660 WP_029377192.1 1159409..1159726(-) (comGC) [Staphylococcus xylosus strain S170]
ATGAATAATTTTAAAAATAAGTTTAACAAAAAGGCATTTACACTCATTGAAATGCTATTGGTTTTATTAATAATAAGTTT
GTTATTAATACTAATAATACCTAATATAGCTAAACAATCCTCACACATACAAACAACTAGTTGTGAAGCGCAACTCAAAA
TGGTAGATAGTCAAATTGAAGCTTATAGTTTGAAGTTCAATAAGAAGCCAACTACTATGGACGAACTCGTCAACGAAGGT
TATATCAAAGAGAACCAAAAACAATGTAAGTCAGGCGCCTTAATATCGATAAATGATGGTGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	70.297	96.19	0.676
comGC	Staphylococcus aureus MW2	70.297	96.19	0.676
comYC	Streptococcus gordonii str. Challis substr. CH1	46.296	100	0.476
comGC/cglC	Streptococcus pneumoniae D39	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae R6	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae TIGR4	39.623	100	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	39.623	100	0.4
comGC/cglC	Streptococcus mitis NCTC 12261	40	100	0.4
comGC/cglC	Streptococcus mitis SK321	41.667	91.429	0.381
comGC	Bacillus subtilis subsp. subtilis str. 168	41.489	89.524	0.371
comYC	Streptococcus mutans UA140	49.351	73.333	0.362
comYC	Streptococcus mutans UA159	49.351	73.333	0.362