Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | AUC50_RS08235 | Genome accession | NZ_CP013621 |
| Coordinates | 1688326..1688637 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain RIVM3897 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1683326..1693637
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AUC50_RS08200 (AUC50_08180) | gcvPA | 1683828..1685174 (-) | 1347 | WP_000019698.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| AUC50_RS08205 (AUC50_08185) | gcvT | 1685194..1686285 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AUC50_RS08210 (AUC50_08190) | - | 1686444..1686968 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| AUC50_RS08215 (AUC50_08195) | - | 1686958..1687104 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| AUC50_RS08220 (AUC50_08200) | comGF | 1687201..1687698 (-) | 498 | WP_001825340.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| AUC50_RS08225 (AUC50_08205) | comGE | 1687616..1687915 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| AUC50_RS08230 (AUC50_08210) | comGD | 1687902..1688348 (-) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AUC50_RS08235 (AUC50_08215) | comGC | 1688326..1688637 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| AUC50_RS08240 (AUC50_08220) | comGB | 1688651..1689721 (-) | 1071 | WP_000776425.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| AUC50_RS08245 (AUC50_08225) | comGA | 1689693..1690667 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| AUC50_RS08250 (AUC50_08230) | - | 1690719..1691342 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| AUC50_RS08255 (AUC50_08235) | - | 1691339..1691668 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| AUC50_RS08260 (AUC50_08240) | - | 1691668..1692654 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| AUC50_RS08265 (AUC50_08245) | - | 1692651..1692854 (-) | 204 | WP_000087559.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=163335 AUC50_RS08235 WP_000472256.1 1688326..1688637(-) (comGC) [Staphylococcus aureus strain RIVM3897]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=163335 AUC50_RS08235 WP_000472256.1 1688326..1688637(-) (comGC) [Staphylococcus aureus strain RIVM3897]
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |