Detailed information
Overview
| Name | comYC | Type | Machinery gene |
| Locus tag | SanJ4211_RS01245 | Genome accession | NZ_CP012805 |
| Coordinates | 227518..227835 (+) | Length | 105 a.a. |
| NCBI ID | WP_003028473.1 | Uniprot ID | A0A0P0N5S2 |
| Organism | Streptococcus anginosus strain J4211 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 215275..257732 | 227518..227835 | within | 0 |
Gene organization within MGE regions
Location: 215275..257732
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SanJ4211_RS01205 (SanJ4211_0212) | rpoC | 217141..220779 (+) | 3639 | WP_021001229.1 | DNA-directed RNA polymerase subunit beta' | - |
| SanJ4211_RS01210 (SanJ4211_0213) | - | 220927..222126 (+) | 1200 | WP_057489559.1 | phosphoglycerate kinase | - |
| SanJ4211_RS01215 (SanJ4211_0214) | - | 222641..223171 (+) | 531 | WP_003032280.1 | FUSC family protein | - |
| SanJ4211_RS01220 (SanJ4211_0215) | - | 223248..223607 (+) | 360 | WP_003028467.1 | MerR family transcriptional regulator | - |
| SanJ4211_RS01225 (SanJ4211_0216) | glnA | 223646..224992 (+) | 1347 | WP_003027006.1 | type I glutamate--ammonia ligase | - |
| SanJ4211_RS01230 (SanJ4211_0217) | - | 225181..225546 (+) | 366 | WP_003027003.1 | DUF1033 family protein | - |
| SanJ4211_RS01235 (SanJ4211_0218) | comYA | 225616..226557 (+) | 942 | WP_003027001.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SanJ4211_RS01240 (SanJ4211_0219) | comYB | 226499..227521 (+) | 1023 | WP_041783985.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SanJ4211_RS01245 (SanJ4211_0220) | comYC | 227518..227835 (+) | 318 | WP_003028473.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SanJ4211_RS01250 (SanJ4211_0221) | comYD | 227795..228223 (+) | 429 | WP_021001232.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SanJ4211_RS01255 (SanJ4211_0222) | comGE/cglE | 228195..228488 (+) | 294 | WP_021001233.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| SanJ4211_RS01260 (SanJ4211_0223) | comGF/cglF | 228472..228909 (+) | 438 | WP_041783987.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SanJ4211_RS01265 | comGG | 228890..229216 (+) | 327 | WP_021001234.1 | competence type IV pilus minor pilin ComGG | - |
| SanJ4211_RS01270 (SanJ4211_0225) | comYH | 229288..230241 (+) | 954 | WP_021001235.1 | class I SAM-dependent methyltransferase | Machinery gene |
| SanJ4211_RS01275 (SanJ4211_0226) | - | 230288..231487 (+) | 1200 | WP_057489560.1 | acetate kinase | - |
| SanJ4211_RS01280 (SanJ4211_0227) | glmS | 231874..233688 (+) | 1815 | WP_049533317.1 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
| SanJ4211_RS01285 (SanJ4211_0228) | - | 234032..236164 (+) | 2133 | WP_057489561.1 | ATP-dependent Clp protease ATP-binding subunit | - |
| SanJ4211_RS01290 (SanJ4211_0229) | ulaG | 236205..236759 (+) | 555 | Protein_224 | L-ascorbate 6-phosphate lactonase | - |
| SanJ4211_RS01295 (SanJ4211_0230) | tkt | 236870..238846 (+) | 1977 | WP_021001237.1 | transketolase | - |
| SanJ4211_RS01300 (SanJ4211_0231) | - | 238942..239430 (+) | 489 | WP_003026974.1 | prolyl-tRNA synthetase associated domain-containing protein | - |
| SanJ4211_RS01305 (SanJ4211_0232) | yajC | 239533..239871 (+) | 339 | WP_003026971.1 | preprotein translocase subunit YajC | - |
| SanJ4211_RS01310 (SanJ4211_0233c) | - | 240253..241470 (-) | 1218 | WP_001291561.1 | tyrosine-type recombinase/integrase | - |
| SanJ4211_RS01315 (SanJ4211_0235c) | - | 241552..241755 (-) | 204 | WP_000814511.1 | excisionase | - |
| SanJ4211_RS10155 | - | 241739..241990 (+) | 252 | WP_001845478.1 | hypothetical protein | - |
| SanJ4211_RS10265 (SanJ4211_0236) | - | 242024..242152 (+) | 129 | WP_000301356.1 | hypothetical protein | - |
| SanJ4211_RS01320 | - | 242216..242446 (-) | 231 | WP_000857133.1 | helix-turn-helix domain-containing protein | - |
| SanJ4211_RS01325 (SanJ4211_0237c) | - | 242443..242865 (-) | 423 | WP_000804885.1 | sigma-70 family RNA polymerase sigma factor | - |
| SanJ4211_RS01330 (SanJ4211_0238) | - | 243369..243722 (+) | 354 | WP_001227347.1 | helix-turn-helix transcriptional regulator | - |
| SanJ4211_RS09720 | - | 243782..243949 (-) | 168 | WP_000336323.1 | cysteine-rich KTR domain-containing protein | - |
| SanJ4211_RS01335 (SanJ4211_0239c) | tet(M) | 244068..245987 (-) | 1920 | WP_000691736.1 | tetracycline resistance ribosomal protection protein Tet(M) | - |
| SanJ4211_RS10310 | - | 246003..246050 (-) | 48 | Protein_237 | hypothetical protein | - |
| SanJ4211_RS01340 (SanJ4211_0240c) | - | 246364..247299 (-) | 936 | WP_001224320.1 | conjugal transfer protein | - |
| SanJ4211_RS01345 (SanJ4211_0241c) | - | 247296..248297 (-) | 1002 | WP_020999616.1 | lysozyme family protein | - |
| SanJ4211_RS01350 (SanJ4211_0242c) | - | 248294..250471 (-) | 2178 | WP_000804748.1 | CD3337/EF1877 family mobilome membrane protein | - |
| SanJ4211_RS01355 (SanJ4211_0243c) | - | 250474..252921 (-) | 2448 | WP_000331160.1 | ATP-binding protein | - |
| SanJ4211_RS01360 | - | 252905..253297 (-) | 393 | WP_000723888.1 | conjugal transfer protein | - |
| SanJ4211_RS01365 (SanJ4211_0245c) | - | 253386..253883 (-) | 498 | WP_000342539.1 | antirestriction protein ArdA | - |
| SanJ4211_RS01370 (SanJ4211_0246c) | - | 254000..254221 (-) | 222 | WP_001009056.1 | hypothetical protein | - |
| SanJ4211_RS01375 (SanJ4211_0247c) | mobT | 254264..255469 (-) | 1206 | WP_000398284.1 | MobT family relaxase | - |
| SanJ4211_RS09730 | - | 255492..255644 (-) | 153 | WP_000879507.1 | hypothetical protein | - |
| SanJ4211_RS01380 (SanJ4211_0248c) | - | 255647..257032 (-) | 1386 | WP_000813488.1 | FtsK/SpoIIIE domain-containing protein | - |
| SanJ4211_RS01385 (SanJ4211_0249c) | - | 257061..257447 (-) | 387 | WP_000985015.1 | YdcP family protein | - |
Sequence
Protein
Download Length: 105 a.a. Molecular weight: 11622.72 Da Isoelectric Point: 10.1006
>NTDB_id=157672 SanJ4211_RS01245 WP_003028473.1 227518..227835(+) (comYC) [Streptococcus anginosus strain J4211]
MKKLKSLKVKGFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVNEGT
ITDKQAASYKAYYAKHTKEARSVAD
MKKLKSLKVKGFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVNEGT
ITDKQAASYKAYYAKHTKEARSVAD
Nucleotide
Download Length: 318 bp
>NTDB_id=157672 SanJ4211_RS01245 WP_003028473.1 227518..227835(+) (comYC) [Streptococcus anginosus strain J4211]
ATGAAAAAATTAAAAAGTTTGAAGGTTAAAGGTTTTACTTTAGTAGAAATGTTAGTCGTACTTCTTATCATCAGTGTTTT
GATGCTCTTATTTGTACCGAATTTGACCAAGCAAAAAGAAGCTGTAACGGAAAAAGGAAATGCAGCGGTGGTAAAAGTTG
TGGAAAGCCAAGCGGAGCTGTTTGAGGTCAATCACACCAATGAAAAAGCGACACTCTCAAAATTAGTCAACGAAGGCACG
ATTACAGACAAGCAGGCAGCATCTTATAAGGCTTACTATGCGAAACATACAAAAGAAGCTCGTTCTGTTGCAGATTAA
ATGAAAAAATTAAAAAGTTTGAAGGTTAAAGGTTTTACTTTAGTAGAAATGTTAGTCGTACTTCTTATCATCAGTGTTTT
GATGCTCTTATTTGTACCGAATTTGACCAAGCAAAAAGAAGCTGTAACGGAAAAAGGAAATGCAGCGGTGGTAAAAGTTG
TGGAAAGCCAAGCGGAGCTGTTTGAGGTCAATCACACCAATGAAAAAGCGACACTCTCAAAATTAGTCAACGAAGGCACG
ATTACAGACAAGCAGGCAGCATCTTATAAGGCTTACTATGCGAAACATACAAAAGAAGCTCGTTCTGTTGCAGATTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
73.333 |
100 |
0.733 |
| comYC | Streptococcus mutans UA159 |
66.667 |
100 |
0.667 |
| comYC | Streptococcus mutans UA140 |
66.667 |
100 |
0.667 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
68.627 |
97.143 |
0.667 |
| comGC/cglC | Streptococcus mitis SK321 |
68.627 |
97.143 |
0.667 |
| comGC/cglC | Streptococcus pneumoniae R6 |
66.667 |
97.143 |
0.648 |
| comGC/cglC | Streptococcus pneumoniae D39 |
66.667 |
97.143 |
0.648 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
66.667 |
97.143 |
0.648 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
66.667 |
97.143 |
0.648 |
| comYC | Streptococcus suis isolate S10 |
66.292 |
84.762 |
0.562 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
54.808 |
99.048 |
0.543 |