Detailed information NTG0156189

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLUC77_RS11960
• Genome accession: NZ_CP015906
• Coordinates: 2308404..2308673 (-)
• Length: 89 a.a.
• NCBI ID: WP_023349160.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. lactis strain UC77
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2303404..2313673

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC77_RS11920 (LLUC77_2358)	-	2303940..2304749 (-)	810	WP_010906310.1	metal ABC transporter permease	-
LLUC77_RS11925 (LLUC77_2359)	-	2304742..2305479 (-)	738	WP_010906311.1	metal ABC transporter ATP-binding protein	-
LLUC77_RS11930 (LLUC77_2360)	-	2305656..2306498 (-)	843	WP_010906312.1	metal ABC transporter substrate-binding protein	-
LLUC77_RS11935 (LLUC77_2361)	-	2306495..2306932 (-)	438	WP_010906313.1	zinc-dependent MarR family transcriptional regulator	-
LLUC77_RS11940 (LLUC77_2362)	comGG	2307013..2307297 (-)	285	WP_010906314.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLUC77_RS11945 (LLUC77_2363)	comGF	2307336..2307782 (-)	447	WP_031296844.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUC77_RS11950 (LLUC77_2364)	comGE	2307745..2308041 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUC77_RS11955 (LLUC77_2365)	comGD	2308013..2308411 (-)	399	WP_021214886.1	competence type IV pilus minor pilin ComGD	Machinery gene
LLUC77_RS11960 (LLUC77_2366)	comGC	2308404..2308673 (-)	270	WP_023349160.1	competence type IV pilus major pilin ComGC	Machinery gene
LLUC77_RS11965 (LLUC77_03470)	-	2308834..2309571 (-)	738	WP_081172231.1	hypothetical protein	-
LLUC77_RS11970 (LLUC77_03475)	-	2309775..2310554 (-)	780	WP_081172233.1	peptidoglycan amidohydrolase family protein	-
LLUC77_RS11975 (LLUC77_03480)	-	2310554..2310841 (-)	288	WP_023164507.1	phage holin	-
LLUC77_RS11980 (LLUC77_03485)	-	2310828..2311154 (-)	327	WP_010905389.1	hypothetical protein	-

Sequence

Protein

• Length: 89 a.a.
• Molecular weight: 10113.52 Da
• Isoelectric Point: 4.2950

>NTDB_id=156189 LLUC77_RS11960 WP_023349160.1 2308404..2308673(-) (comGC) [Lactococcus lactis subsp. lactis strain UC77]
MLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLSELLSAGMITQKQISAYDNYYDQN
KNEERNFND

Nucleotide

• Length: 270 bp

>NTDB_id=156189 LLUC77_RS11960 WP_023349160.1 2308404..2308673(-) (comGC) [Lactococcus lactis subsp. lactis strain UC77]
ATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCA
AAAAACTGGAGAAGCGGCAGTTGTCAAAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGC
CGAGTCTGTCAGAATTGCTCAGTGCAGGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAAT
AAAAATGAAGAACGAAATTTTAATGACTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	88	84.27	0.742
comGC	Streptococcus gordonii str. Challis substr. CH1	57.647	95.506	0.551
comGC/cglC	Streptococcus pneumoniae Rx1	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae D39	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae R6	55.056	100	0.551
comGC/cglC	Streptococcus pneumoniae TIGR4	55.056	100	0.551
comGC	Streptococcus suis isolate S10	58.904	82.022	0.483
comGC/cglC	Streptococcus mitis SK321	55.263	85.393	0.472
comGC	Streptococcus mutans UA140	52.055	82.022	0.427
comGC	Streptococcus mutans UA159	52.055	82.022	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	57.812	71.91	0.416