Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LLUC77_RS11940 Genome accession   NZ_CP015906
Coordinates   2307013..2307297 (-) Length   94 a.a.
NCBI ID   WP_010906314.1    Uniprot ID   Q9CDU4
Organism   Lactococcus lactis subsp. lactis strain UC77     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2302013..2312297
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUC77_RS11910 (LLUC77_2356) - 2302453..2302830 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LLUC77_RS11915 (LLUC77_2357) - 2303035..2303901 (+) 867 WP_010906309.1 RluA family pseudouridine synthase -
  LLUC77_RS11920 (LLUC77_2358) - 2303940..2304749 (-) 810 WP_010906310.1 metal ABC transporter permease -
  LLUC77_RS11925 (LLUC77_2359) - 2304742..2305479 (-) 738 WP_010906311.1 metal ABC transporter ATP-binding protein -
  LLUC77_RS11930 (LLUC77_2360) - 2305656..2306498 (-) 843 WP_010906312.1 metal ABC transporter substrate-binding protein -
  LLUC77_RS11935 (LLUC77_2361) - 2306495..2306932 (-) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  LLUC77_RS11940 (LLUC77_2362) comGG 2307013..2307297 (-) 285 WP_010906314.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUC77_RS11945 (LLUC77_2363) comGF 2307336..2307782 (-) 447 WP_031296844.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUC77_RS11950 (LLUC77_2364) comGE 2307745..2308041 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUC77_RS11955 (LLUC77_2365) comGD 2308013..2308411 (-) 399 WP_021214886.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLUC77_RS11960 (LLUC77_2366) comGC 2308404..2308673 (-) 270 WP_023349160.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUC77_RS11965 (LLUC77_03470) - 2308834..2309571 (-) 738 WP_081172231.1 hypothetical protein -
  LLUC77_RS11970 (LLUC77_03475) - 2309775..2310554 (-) 780 WP_081172233.1 peptidoglycan amidohydrolase family protein -
  LLUC77_RS11975 (LLUC77_03480) - 2310554..2310841 (-) 288 WP_023164507.1 phage holin -
  LLUC77_RS11980 (LLUC77_03485) - 2310828..2311154 (-) 327 WP_010905389.1 hypothetical protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=156185 LLUC77_RS11940 WP_010906314.1 2307013..2307297(-) (comGG) [Lactococcus lactis subsp. lactis strain UC77]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN

Nucleotide


Download         Length: 285 bp        

>NTDB_id=156185 LLUC77_RS11940 WP_010906314.1 2307013..2307297(-) (comGG) [Lactococcus lactis subsp. lactis strain UC77]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9CDU4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

59.14

98.936

0.585

Multiple sequence alignment