Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | AYM22_RS08830 | Genome accession | NZ_CP014392 |
| Coordinates | 1702052..1702363 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain USA300-SUR9 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1697052..1707363
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYM22_RS08795 (AYM22_08560) | gcvPA | 1697554..1698900 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| AYM22_RS08800 (AYM22_08565) | gcvT | 1698920..1700011 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AYM22_RS08805 (AYM22_08570) | - | 1700170..1700694 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| AYM22_RS08810 (AYM22_08575) | - | 1700684..1700830 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| AYM22_RS08815 (AYM22_08580) | comGF | 1700927..1701424 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| AYM22_RS08820 (AYM22_08585) | comGE | 1701342..1701641 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| AYM22_RS08825 (AYM22_08590) | comGD | 1701628..1702074 (-) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AYM22_RS08830 (AYM22_08595) | comGC | 1702052..1702363 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| AYM22_RS08835 (AYM22_08600) | comGB | 1702377..1703447 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| AYM22_RS08840 (AYM22_08605) | comGA | 1703419..1704393 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| AYM22_RS08845 (AYM22_08610) | - | 1704445..1705068 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| AYM22_RS08850 (AYM22_08615) | - | 1705065..1705394 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| AYM22_RS08855 (AYM22_08620) | - | 1705394..1706380 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| AYM22_RS08860 (AYM22_08625) | - | 1706377..1706580 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=146352 AYM22_RS08830 WP_000472256.1 1702052..1702363(-) (comGC) [Staphylococcus aureus strain USA300-SUR9]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=146352 AYM22_RS08830 WP_000472256.1 1702052..1702363(-) (comGC) [Staphylococcus aureus strain USA300-SUR9]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |