Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | FCFHV36_RS07500 | Genome accession | NZ_CP011147 |
| Coordinates | 1560569..1560880 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain FCFHV36 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1555569..1565880
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FCFHV36_RS07465 (FCFHV36_1378) | gcvPA | 1556071..1557417 (-) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| FCFHV36_RS07470 (FCFHV36_1379) | gcvT | 1557437..1558528 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| FCFHV36_RS07475 (FCFHV36_1380) | - | 1558687..1559211 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| FCFHV36_RS15265 | - | 1559201..1559347 (-) | 147 | WP_001792109.1 | hypothetical protein | - |
| FCFHV36_RS07485 (FCFHV36_1381) | comGF | 1559444..1559941 (-) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| FCFHV36_RS07490 (FCFHV36_1382) | comGE | 1559859..1560158 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| FCFHV36_RS07495 (FCFHV36_1383) | comGD | 1560145..1560591 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| FCFHV36_RS07500 (FCFHV36_1384) | comGC | 1560569..1560880 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| FCFHV36_RS07505 (FCFHV36_1385) | comGB | 1560894..1561964 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| FCFHV36_RS07510 (FCFHV36_1386) | comGA | 1561936..1562910 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| FCFHV36_RS07515 (FCFHV36_1387) | - | 1562962..1563585 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| FCFHV36_RS07520 (FCFHV36_1388) | - | 1563582..1563911 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| FCFHV36_RS07525 (FCFHV36_1389) | - | 1563911..1564897 (-) | 987 | WP_000161311.1 | ROK family glucokinase | - |
| FCFHV36_RS07530 | - | 1564894..1565097 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=142782 FCFHV36_RS07500 WP_000472256.1 1560569..1560880(-) (comGC) [Staphylococcus aureus strain FCFHV36]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=142782 FCFHV36_RS07500 WP_000472256.1 1560569..1560880(-) (comGC) [Staphylococcus aureus strain FCFHV36]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |