Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SABE62_RS08745 | Genome accession | NZ_CP012013 |
| Coordinates | 1738894..1739205 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain Be62 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1733894..1744205
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SABE62_RS08710 (SABE62_01799) | gcvPA | 1734396..1735742 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SABE62_RS08715 (SABE62_01800) | gcvT | 1735762..1736853 (-) | 1092 | WP_000093351.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SABE62_RS08720 (SABE62_01801) | - | 1737012..1737536 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| SABE62_RS08725 | - | 1737526..1737672 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SABE62_RS08730 (SABE62_01802) | comGF | 1737769..1738266 (-) | 498 | WP_001803317.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SABE62_RS08735 (SABE62_01803) | comGE | 1738184..1738483 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| SABE62_RS08740 (SABE62_01804) | comGD | 1738470..1738916 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SABE62_RS08745 (SABE62_01805) | comGC | 1738894..1739205 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SABE62_RS08750 (SABE62_01806) | comGB | 1739219..1740289 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SABE62_RS08755 (SABE62_01807) | comGA | 1740261..1741235 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SABE62_RS08760 (SABE62_01808) | - | 1741287..1741910 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SABE62_RS08765 (SABE62_01809) | - | 1741907..1742236 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SABE62_RS08770 (SABE62_01810) | - | 1742236..1743222 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| SABE62_RS08775 | - | 1743219..1743422 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=130484 SABE62_RS08745 WP_000472256.1 1738894..1739205(-) (comGC) [Staphylococcus aureus strain Be62]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=130484 SABE62_RS08745 WP_000472256.1 1738894..1739205(-) (comGC) [Staphylococcus aureus strain Be62]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |