Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | X998_RS04150 | Genome accession | NZ_CP007539 |
| Coordinates | 752297..752608 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain FDAARGOS_5 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 739705..797107 | 752297..752608 | within | 0 |
Gene organization within MGE regions
Location: 739705..797107
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| X998_RS04080 (X998_1581) | - | 740456..741241 (+) | 786 | WP_001213908.1 | metal ABC transporter ATP-binding protein | - |
| X998_RS04085 (X998_1580) | - | 741283..742146 (+) | 864 | WP_000564316.1 | metal ABC transporter permease | - |
| X998_RS04090 (X998_1579) | - | 742133..742543 (+) | 411 | WP_001095260.1 | Fur family transcriptional regulator | - |
| X998_RS04095 (X998_1578) | - | 742819..743418 (+) | 600 | WP_000863556.1 | superoxide dismutase | - |
| X998_RS04100 (X998_1577) | - | 743539..745614 (+) | 2076 | WP_000919772.1 | peptidoglycan D,D-transpeptidase FtsI family protein | - |
| X998_RS04105 (X998_1576) | rpmG | 745727..745876 (+) | 150 | WP_001265709.1 | 50S ribosomal protein L33 | - |
| X998_RS04110 (X998_1575) | - | 746085..746624 (+) | 540 | WP_000164545.1 | 5-formyltetrahydrofolate cyclo-ligase | - |
| X998_RS04115 (X998_1574) | - | 746636..748099 (+) | 1464 | WP_001017867.1 | rhomboid family protein | - |
| X998_RS04120 (X998_04060) | - | 748080..748283 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| X998_RS04125 (X998_1573) | - | 748280..749266 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| X998_RS04130 (X998_1572) | - | 749266..749595 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| X998_RS04135 (X998_1571) | - | 749592..750215 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| X998_RS04140 (X998_1570) | comGA | 750267..751241 (+) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| X998_RS04145 (X998_1569) | comGB | 751213..752283 (+) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| X998_RS04150 (X998_1568) | comGC | 752297..752608 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| X998_RS04155 (X998_1567) | comGD | 752586..753032 (+) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| X998_RS04160 (X998_1566) | comGE | 753019..753318 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| X998_RS04165 (X998_1565) | comGF | 753236..753733 (+) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| X998_RS04170 (X998_04065) | - | 753830..753976 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| X998_RS04175 (X998_1564) | - | 753966..754490 (+) | 525 | WP_001015117.1 | shikimate kinase | - |
| X998_RS04180 (X998_1563) | gcvT | 754649..755740 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| X998_RS04185 (X998_1562) | gcvPA | 755760..757106 (+) | 1347 | WP_000019693.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| X998_RS04190 (X998_1561) | gcvPB | 757099..758571 (+) | 1473 | WP_000202192.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPB | - |
| X998_RS04195 (X998_1560) | - | 758936..759322 (-) | 387 | WP_001276571.1 | rhodanese-like domain-containing protein | - |
| X998_RS04200 (X998_1559) | - | 759480..760310 (+) | 831 | WP_000141109.1 | biotin/lipoate A/B protein ligase family protein | - |
| X998_RS04205 (X998_1558) | - | 760374..760592 (-) | 219 | WP_001244298.1 | SA1362 family protein | - |
| X998_RS04210 (X998_1557) | - | 760606..761187 (-) | 582 | WP_000737686.1 | hypothetical protein | - |
| X998_RS04215 (X998_1556) | - | 761292..762353 (+) | 1062 | WP_000087107.1 | M24 family metallopeptidase | - |
| X998_RS04220 (X998_1555) | efp | 762379..762936 (+) | 558 | WP_000626504.1 | elongation factor P | - |
| X998_RS04225 (X998_1554) | - | 763331..763615 (+) | 285 | WP_000134545.1 | hypothetical protein | - |
| X998_RS04230 (X998_1553) | - | 763766..764086 (+) | 321 | WP_000805733.1 | DUF961 family protein | - |
| X998_RS04235 (X998_1552) | - | 764100..764402 (+) | 303 | WP_000386891.1 | hypothetical protein | - |
| X998_RS04240 (X998_1551) | - | 764577..765668 (+) | 1092 | WP_000172943.1 | replication initiation factor domain-containing protein | - |
| X998_RS04245 (X998_1550) | - | 765729..766784 (+) | 1056 | WP_000692002.1 | conjugal transfer protein | - |
| X998_RS04250 (X998_1549) | - | 766789..767049 (+) | 261 | WP_000015639.1 | TcpD family membrane protein | - |
| X998_RS04255 (X998_1548) | - | 767061..767444 (+) | 384 | WP_000358144.1 | TcpE family conjugal transfer membrane protein | - |
| X998_RS04260 (X998_1547) | - | 767479..769974 (+) | 2496 | WP_001049264.1 | ATP-binding protein | - |
| X998_RS04265 (X998_1546) | - | 770028..771386 (+) | 1359 | WP_001251212.1 | FtsK/SpoIIIE domain-containing protein | - |
| X998_RS04270 (X998_1545) | - | 771391..773238 (+) | 1848 | WP_000681143.1 | CD3337/EF1877 family mobilome membrane protein | - |
| X998_RS04275 (X998_1544) | - | 773228..774274 (+) | 1047 | WP_000247469.1 | CHAP domain-containing protein | - |
| X998_RS04280 (X998_1543) | - | 774281..774871 (+) | 591 | WP_000810443.1 | hypothetical protein | - |
| X998_RS04285 (X998_1542) | - | 774927..775268 (+) | 342 | WP_001255377.1 | cystatin-like fold lipoprotein | - |
| X998_RS14620 | - | 775377..775880 (+) | 504 | WP_000746371.1 | transposase | - |
| X998_RS14625 | - | 775909..776397 (+) | 489 | WP_176318786.1 | IS30 family transposase | - |
| X998_RS04295 (X998_1539) | accB | 776752..777216 (+) | 465 | WP_001009516.1 | acetyl-CoA carboxylase biotin carboxyl carrier protein | - |
| X998_RS04300 (X998_1538) | accC | 777216..778571 (+) | 1356 | WP_000756612.1 | acetyl-CoA carboxylase biotin carboxylase subunit | - |
| X998_RS04305 (X998_1537) | - | 778586..778948 (+) | 363 | WP_000241588.1 | Asp23/Gls24 family envelope stress response protein | - |
| X998_RS04310 (X998_1536) | nusB | 779008..779397 (+) | 390 | WP_000087385.1 | transcription antitermination factor NusB | - |
| X998_RS04315 (X998_1535) | xseA | 779414..780751 (+) | 1338 | WP_001286928.1 | exodeoxyribonuclease VII large subunit | - |
| X998_RS04320 (X998_1534) | - | 780744..780974 (+) | 231 | WP_000159865.1 | exodeoxyribonuclease VII small subunit | - |
| X998_RS04325 (X998_1533) | - | 780952..781833 (+) | 882 | WP_000183378.1 | polyprenyl synthetase family protein | - |
| X998_RS04330 (X998_1532) | ahrC | 782265..782717 (+) | 453 | WP_001124985.1 | transcriptional regulator AhrC/ArgR | - |
| X998_RS04335 (X998_1531) | recN | 782733..784412 (+) | 1680 | WP_000942211.1 | DNA repair protein RecN | - |
| X998_RS04340 (X998_1530) | lpdA | 784563..785984 (+) | 1422 | WP_001291535.1 | dihydrolipoyl dehydrogenase | - |
| X998_RS04345 (X998_1529) | - | 786000..786992 (+) | 993 | WP_000568353.1 | thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha | - |
| X998_RS04350 (X998_1528) | - | 786992..787975 (+) | 984 | WP_001096642.1 | alpha-ketoacid dehydrogenase subunit beta | - |
| X998_RS04355 (X998_1527) | - | 787988..789262 (+) | 1275 | WP_000406839.1 | dihydrolipoamide acetyltransferase family protein | - |
| X998_RS04360 (X998_1526) | brxB | 789613..790050 (+) | 438 | WP_000367419.1 | bacilliredoxin BrxB | - |
| X998_RS04365 (X998_1525) | - | 790064..791044 (+) | 981 | WP_000916195.1 | aromatic acid exporter family protein | - |
| X998_RS04370 (X998_1524) | prli42 | 791171..791350 (-) | 180 | WP_001789875.1 | stressosome-associated protein Prli42 | - |
| X998_RS04375 (X998_1523) | - | 791613..792746 (+) | 1134 | WP_000606676.1 | tripeptidase T | - |
| X998_RS04380 (X998_1522) | gndA | 792814..794220 (+) | 1407 | WP_000193707.1 | NADP-dependent phosphogluconate dehydrogenase | - |
| X998_RS04385 (X998_1521) | - | 794439..794810 (+) | 372 | WP_000413437.1 | VOC family protein | - |
| X998_RS04390 (X998_04075) | - | 794749..795003 (+) | 255 | WP_001791638.1 | hypothetical protein | - |
| X998_RS04395 (X998_1520) | - | 795004..796023 (+) | 1020 | WP_000256338.1 | LacI family DNA-binding transcriptional regulator | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=120673 X998_RS04150 WP_000472256.1 752297..752608(+) (comGC) [Staphylococcus aureus strain FDAARGOS_5]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=120673 X998_RS04150 WP_000472256.1 752297..752608(+) (comGC) [Staphylococcus aureus strain FDAARGOS_5]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |