Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | ACLV7H_RS09920 | Genome accession | NZ_OZ217340 |
| Coordinates | 1948336..1948461 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799678.1 | Uniprot ID | - |
| Organism | Streptococcus oralis isolate S. oralis A22 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1943336..1953461
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACLV7H_RS09895 (SORA22_19940) | - | 1945470..1946012 (+) | 543 | WP_411867057.1 | TetR/AcrR family transcriptional regulator C-terminal domain-containing protein | - |
| ACLV7H_RS09910 (SORA22_19970) | comE | 1946247..1946999 (-) | 753 | WP_045592607.1 | competence system response regulator transcription factor ComE | Regulator |
| ACLV7H_RS09915 (SORA22_19980) | comD | 1946996..1948315 (-) | 1320 | Protein_1906 | competence system sensor histidine kinase ComD | - |
| ACLV7H_RS09920 (SORA22_19990) | comC/comC2 | 1948336..1948461 (-) | 126 | WP_000799678.1 | competence-stimulating peptide ComC | Regulator |
| ACLV7H_RS09930 (SORA22_20010) | rlmH | 1948743..1949222 (-) | 480 | WP_411867058.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| ACLV7H_RS09935 (SORA22_20020) | htrA | 1949409..1950602 (+) | 1194 | WP_411867059.1 | S1C family serine protease | Regulator |
| ACLV7H_RS09940 (SORA22_20030) | spo0J | 1950660..1951418 (+) | 759 | WP_411867060.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| ACLV7H_RS09945 | - | 1951635..1952063 (+) | 429 | Protein_1911 | hypothetical protein | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4960.73 Da Isoelectric Point: 10.3052
>NTDB_id=1169994 ACLV7H_RS09920 WP_000799678.1 1948336..1948461(-) (comC/comC2) [Streptococcus oralis isolate S. oralis A22]
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
MKNTVKLEQFKEVTEAELQEIRGGDWRISETIRNLIFPRRK
Nucleotide
Download Length: 126 bp
>NTDB_id=1169994 ACLV7H_RS09920 WP_000799678.1 1948336..1948461(-) (comC/comC2) [Streptococcus oralis isolate S. oralis A22]
ATGAAGAATACAGTAAAGTTGGAACAATTTAAAGAGGTAACAGAGGCAGAATTGCAGGAGATTCGGGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAACCTTATTTTTCCAAGAAGAAAGTAA
ATGAAGAATACAGTAAAGTTGGAACAATTTAAAGAGGTAACAGAGGCAGAATTGCAGGAGATTCGGGGTGGAGATTGGAG
AATTTCAGAAACAATTCGTAACCTTATTTTTCCAAGAAGAAAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
56.098 |
100 |
0.561 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
56.098 |
100 |
0.561 |
| comC | Streptococcus mitis SK321 |
56.098 |
100 |
0.561 |
| comC/comC1 | Streptococcus pneumoniae R6 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae G54 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae D39 |
53.659 |
100 |
0.537 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
53.659 |
100 |
0.537 |
| comC | Streptococcus mitis NCTC 12261 |
47.5 |
97.561 |
0.463 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
43.243 |
90.244 |
0.39 |
| comC/comC1 | Streptococcus gordonii str. Challis substr. CH1 |
39.474 |
92.683 |
0.366 |