Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | QML74_RS05345 | Genome accession | NZ_OX346404 |
| Coordinates | 1044923..1045393 (+) | Length | 156 a.a. |
| NCBI ID | WP_281957977.1 | Uniprot ID | - |
| Organism | Enterococcus cecorum isolate CIRMBP-1281 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1006697..1059173 | 1044923..1045393 | within | 0 |
Gene organization within MGE regions
Location: 1006697..1059173
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QML74_RS05160 (CIRMBP1281_01040) | - | 1007992..1008438 (+) | 447 | WP_114975413.1 | hypothetical protein | - |
| QML74_RS05165 (CIRMBP1281_01041) | - | 1008439..1009134 (-) | 696 | WP_114975414.1 | hypothetical protein | - |
| QML74_RS05170 (CIRMBP1281_01042) | - | 1009269..1009478 (+) | 210 | WP_047338730.1 | helix-turn-helix transcriptional regulator | - |
| QML74_RS05175 (CIRMBP1281_01043) | - | 1009618..1011948 (+) | 2331 | WP_281957971.1 | isopeptide-forming domain-containing fimbrial protein | - |
| QML74_RS05180 (CIRMBP1281_01044) | - | 1012007..1013014 (+) | 1008 | WP_281957972.1 | isopeptide-forming domain-containing fimbrial protein | - |
| QML74_RS05185 (CIRMBP1281_01045) | - | 1013047..1013964 (+) | 918 | WP_281957973.1 | hypothetical protein | - |
| QML74_RS05190 (CIRMBP1281_01046) | - | 1014078..1014335 (+) | 258 | WP_171332632.1 | hypothetical protein | - |
| QML74_RS05195 (CIRMBP1281_01047) | - | 1014336..1014569 (+) | 234 | WP_047338943.1 | TrbC/VirB2 family protein | - |
| QML74_RS05200 (CIRMBP1281_01048) | - | 1014625..1016856 (+) | 2232 | WP_281957974.1 | hypothetical protein | - |
| QML74_RS05205 (CIRMBP1281_01049) | - | 1016843..1019542 (+) | 2700 | WP_281957975.1 | type IV secretory system conjugative DNA transfer family protein | - |
| QML74_RS05210 (CIRMBP1281_01050) | - | 1019564..1022317 (+) | 2754 | WP_243180007.1 | pLS20_p028 family conjugation system transmembrane protein | - |
| QML74_RS05215 (CIRMBP1281_01051) | - | 1022382..1022723 (+) | 342 | WP_047334877.1 | DUF5592 family protein | - |
| QML74_RS05220 (CIRMBP1281_01052) | - | 1022725..1023324 (+) | 600 | WP_047334876.1 | hypothetical protein | - |
| QML74_RS05225 (CIRMBP1281_01053) | - | 1023489..1025435 (+) | 1947 | WP_087216189.1 | hypothetical protein | - |
| QML74_RS05230 | - | 1025537..1026130 (+) | 594 | Protein_992 | lysozyme family protein | - |
| QML74_RS05235 | - | 1026194..1026544 (+) | 351 | Protein_993 | C40 family peptidase | - |
| QML74_RS05240 (CIRMBP1281_01055) | - | 1026592..1027353 (+) | 762 | WP_281957976.1 | hypothetical protein | - |
| QML74_RS05245 (CIRMBP1281_01056) | - | 1027366..1028475 (+) | 1110 | WP_243180009.1 | hypothetical protein | - |
| QML74_RS05250 (CIRMBP1281_01057) | - | 1028744..1029190 (+) | 447 | WP_171378602.1 | hypothetical protein | - |
| QML74_RS05255 (CIRMBP1281_01058) | - | 1029218..1029502 (+) | 285 | WP_243180010.1 | hypothetical protein | - |
| QML74_RS05260 (CIRMBP1281_01059) | - | 1029495..1029716 (+) | 222 | WP_243180012.1 | hypothetical protein | - |
| QML74_RS05265 (CIRMBP1281_01060) | - | 1029729..1030007 (+) | 279 | WP_047335105.1 | hypothetical protein | - |
| QML74_RS05270 (CIRMBP1281_01061) | - | 1030029..1030232 (+) | 204 | WP_047335106.1 | hypothetical protein | - |
| QML74_RS05275 (CIRMBP1281_01062) | - | 1030249..1030767 (+) | 519 | WP_243180015.1 | hypothetical protein | - |
| QML74_RS05280 (CIRMBP1281_01063) | radC | 1031125..1031574 (+) | 450 | WP_047335108.1 | DNA repair protein RadC | - |
| QML74_RS05285 (CIRMBP1281_01064) | - | 1032014..1032337 (+) | 324 | WP_168930126.1 | hypothetical protein | - |
| QML74_RS05290 (CIRMBP1281_01065) | - | 1032321..1032677 (+) | 357 | WP_047338929.1 | hypothetical protein | - |
| QML74_RS05295 (CIRMBP1281_01066) | mobP2 | 1032696..1034591 (+) | 1896 | WP_243180017.1 | MobP2 family relaxase | - |
| QML74_RS05300 (CIRMBP1281_01067) | - | 1034745..1036070 (+) | 1326 | WP_243180283.1 | type III toxin-antitoxin system ToxN/AbiQ family toxin | - |
| QML74_RS05305 (CIRMBP1281_01068) | - | 1036231..1036551 (+) | 321 | WP_168930123.1 | hypothetical protein | - |
| QML74_RS05310 (CIRMBP1281_01069) | - | 1036579..1037040 (+) | 462 | WP_171378613.1 | hypothetical protein | - |
| QML74_RS05315 (CIRMBP1281_01070) | - | 1037040..1039052 (+) | 2013 | WP_243180281.1 | LPD1 domain-containing protein | - |
| QML74_RS05320 (CIRMBP1281_01071) | - | 1039185..1040342 (+) | 1158 | WP_243180279.1 | DUF3991 domain-containing protein | - |
| QML74_RS05325 (CIRMBP1281_01072) | - | 1040339..1041112 (+) | 774 | WP_052836427.1 | thermonuclease family protein | - |
| QML74_RS05330 (CIRMBP1281_01073) | - | 1041121..1041846 (+) | 726 | WP_243180277.1 | class A sortase | - |
| QML74_RS05335 (CIRMBP1281_01074) | - | 1041885..1042304 (+) | 420 | WP_243192884.1 | hypothetical protein | - |
| QML74_RS05340 (CIRMBP1281_01075) | - | 1042301..1044463 (+) | 2163 | WP_171378620.1 | type IA DNA topoisomerase | - |
| QML74_RS05345 (CIRMBP1281_01076) | ssb | 1044923..1045393 (+) | 471 | WP_281957977.1 | single-stranded DNA-binding protein | Machinery gene |
| QML74_RS05350 (CIRMBP1281_01077) | - | 1045468..1045728 (+) | 261 | WP_047338919.1 | hypothetical protein | - |
| QML74_RS05355 (CIRMBP1281_01078) | - | 1045831..1046124 (+) | 294 | WP_087216392.1 | hypothetical protein | - |
| QML74_RS05360 (CIRMBP1281_01079) | - | 1046227..1046439 (+) | 213 | WP_047334073.1 | hypothetical protein | - |
| QML74_RS05365 (CIRMBP1281_01080) | - | 1046454..1047272 (+) | 819 | WP_171332645.1 | ParA family protein | - |
| QML74_RS05370 | - | 1047381..1047632 (+) | 252 | WP_047334075.1 | hypothetical protein | - |
| QML74_RS05375 (CIRMBP1281_01081) | - | 1047662..1049047 (+) | 1386 | WP_171332646.1 | ISLre2 family transposase | - |
| QML74_RS05380 (CIRMBP1281_01082) | glyQ | 1050203..1051111 (+) | 909 | WP_016251894.1 | glycine--tRNA ligase subunit alpha | - |
| QML74_RS05385 (CIRMBP1281_01083) | glyS | 1051116..1053182 (+) | 2067 | WP_281957978.1 | glycine--tRNA ligase subunit beta | - |
| QML74_RS05390 (CIRMBP1281_01084) | - | 1053423..1054103 (-) | 681 | WP_047242068.1 | metal-dependent hydrolase | - |
| QML74_RS05395 (CIRMBP1281_01085) | - | 1054167..1055114 (-) | 948 | WP_047242067.1 | AEC family transporter | - |
| QML74_RS05400 (CIRMBP1281_01086) | yidC | 1055213..1056175 (-) | 963 | WP_016251898.1 | membrane protein insertase YidC | - |
| QML74_RS05405 (CIRMBP1281_01087) | - | 1056261..1056548 (-) | 288 | WP_016251899.1 | acylphosphatase | - |
| QML74_RS05410 (CIRMBP1281_01088) | - | 1056651..1057418 (+) | 768 | WP_016251900.1 | RNA methyltransferase | - |
| QML74_RS05415 (CIRMBP1281_01089) | - | 1057508..1058002 (+) | 495 | WP_047242066.1 | hypothetical protein | - |
| QML74_RS05420 (CIRMBP1281_01090) | - | 1058131..1058823 (+) | 693 | WP_281957979.1 | DUF5105 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17620.47 Da Isoelectric Point: 6.3633
>NTDB_id=1155034 QML74_RS05345 WP_281957977.1 1044923..1045393(+) (ssb) [Enterococcus cecorum isolate CIRMBP-1281]
MINNVTLVGRLTRDADLRYTASGVAVATFNLAVNRNYSNQNGERETDFINCVIWRKPAENLANYTRKGSLIGLTGRLQTR
NYENQQGQRVYVTEVIVENFQMLESREVTKNRKQAANQTNQASNPTNTTSQPTQPFMDYSSFGGQSVEISEDDLPF
MINNVTLVGRLTRDADLRYTASGVAVATFNLAVNRNYSNQNGERETDFINCVIWRKPAENLANYTRKGSLIGLTGRLQTR
NYENQQGQRVYVTEVIVENFQMLESREVTKNRKQAANQTNQASNPTNTTSQPTQPFMDYSSFGGQSVEISEDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1155034 QML74_RS05345 WP_281957977.1 1044923..1045393(+) (ssb) [Enterococcus cecorum isolate CIRMBP-1281]
ATGATTAACAACGTCACATTAGTAGGTAGATTAACAAGAGATGCAGACTTACGATATACTGCATCAGGAGTCGCAGTAGC
AACATTTAATTTAGCGGTTAATCGTAACTATAGCAATCAAAATGGCGAAAGAGAAACCGACTTTATCAATTGTGTGATTT
GGCGAAAACCTGCGGAAAATTTAGCAAATTATACAAGAAAAGGTAGCTTGATTGGTTTAACAGGTAGATTGCAAACAAGG
AATTATGAAAATCAACAAGGACAACGTGTGTATGTGACCGAAGTAATTGTAGAGAATTTTCAGATGTTAGAGTCCAGGGA
AGTCACTAAAAATCGCAAACAGGCAGCAAACCAAACTAATCAAGCATCTAATCCAACTAATACTACATCTCAACCAACAC
AACCATTTATGGATTATTCATCCTTTGGTGGCCAAAGTGTAGAAATTAGTGAAGATGATCTACCATTTTAA
ATGATTAACAACGTCACATTAGTAGGTAGATTAACAAGAGATGCAGACTTACGATATACTGCATCAGGAGTCGCAGTAGC
AACATTTAATTTAGCGGTTAATCGTAACTATAGCAATCAAAATGGCGAAAGAGAAACCGACTTTATCAATTGTGTGATTT
GGCGAAAACCTGCGGAAAATTTAGCAAATTATACAAGAAAAGGTAGCTTGATTGGTTTAACAGGTAGATTGCAAACAAGG
AATTATGAAAATCAACAAGGACAACGTGTGTATGTGACCGAAGTAATTGTAGAGAATTTTCAGATGTTAGAGTCCAGGGA
AGTCACTAAAAATCGCAAACAGGCAGCAAACCAAACTAATCAAGCATCTAATCCAACTAATACTACATCTCAACCAACAC
AACCATTTATGGATTATTCATCCTTTGGTGGCCAAAGTGTAGAAATTAGTGAAGATGATCTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.046 |
100 |
0.647 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.581 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.846 |
75 |
0.404 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50.847 |
75.641 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
50.847 |
75.641 |
0.385 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.066 |
87.821 |
0.378 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
50 |
75.641 |
0.378 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
50 |
75.641 |
0.378 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
50 |
75.641 |
0.378 |
| ssbB/cilA | Streptococcus mitis SK321 |
50 |
75.641 |
0.378 |