Detailed information NTG1154329

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: AD178_RS07400
• Genome accession: NZ_OX244288
• Coordinates: 1456076..1456546 (-)
• Length: 156 a.a.
• NCBI ID: WP_000609607.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae strain PT8105 isolate 2RLC4
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	1457130..1459506	1456076..1456546	flank	584

Gene organization within MGE regions

Location: 1456076..1459506

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AD178_RS07400 (SAMEA1463109_01496)	ssbA	1456076..1456546 (-)	471	WP_000609607.1	single-stranded DNA-binding protein SsbA	Machinery gene
AD178_RS07405 (SAMEA1463109_01497)	rpsF	1456558..1456848 (-)	291	WP_001151785.1	30S ribosomal protein S6	-
AD178_RS07410 (SAMEA1463109_01498)	-	1457130..1458128 (+)	999	Protein_1470	ISL3 family transposase	-
AD178_RS07415 (SAMEA1463109_01499)	-	1458250..1459506 (+)	1257	WP_000436180.1	ISL3-like element IS1167A family transposase	-

Sequence

Protein

• Length: 156 a.a.
• Molecular weight: 17351.21 Da
• Isoelectric Point: 5.2065

>NTDB_id=1154329 AD178_RS07400 WP_000609607.1 1456076..1456546(-) (ssbA) [Streptococcus pneumoniae strain PT8105 isolate 2RLC4]
MINNVVLVGRMTRDAELRYTPSNVAVATFTLAVNRTFKSQNGEREADFINVVMWRQQAENLANWAKKGSLIGVTGRIQTR
SYDNQQGQRVYVTEVVAENFQMLESRSVREGHTGGAYSAPTANYSAPTNSVPDFSRNENPFGATNPLDISDDDLPF

Nucleotide

• Length: 471 bp

>NTDB_id=1154329 AD178_RS07400 WP_000609607.1 1456076..1456546(-) (ssbA) [Streptococcus pneumoniae strain PT8105 isolate 2RLC4]
ATGATTAACAATGTTGTACTTGTAGGGCGTATGACACGTGACGCTGAGTTGCGTTATACCCCATCAAATGTAGCAGTTGC
GACTTTTACTCTTGCAGTAAACCGTACATTTAAGAGTCAAAATGGTGAACGTGAGGCTGATTTTATCAATGTCGTTATGT
GGCGCCAACAGGCTGAAAATCTTGCTAACTGGGCTAAAAAAGGCTCACTTATCGGGGTGACAGGTCGTATCCAGACTCGT
AGTTACGATAACCAGCAAGGACAACGTGTCTACGTGACAGAGGTCGTGGCTGAGAATTTCCAAATGTTGGAAAGCCGTAG
TGTGCGTGAGGGCCACACAGGTGGAGCTTACTCTGCACCAACTGCAAACTATTCAGCACCTACAAATTCAGTACCAGACT
TTTCACGTAATGAAAATCCATTTGGAGCAACAAACCCATTGGATATTTCAGATGATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	55.814	100	0.615
ssb	Latilactobacillus sakei subsp. sakei 23K	54.118	100	0.59
ssbB	Bacillus subtilis subsp. subtilis str. 168	55.66	67.949	0.378
ssbB	Streptococcus sobrinus strain NIDR 6715-7	54.128	69.872	0.378
ssbB/cilA	Streptococcus pneumoniae TIGR4	53.211	69.872	0.372
ssbB/cilA	Streptococcus mitis SK321	52.294	69.872	0.365
ssbB/cilA	Streptococcus mitis NCTC 12261	52.294	69.872	0.365
ssbB/cilA	Streptococcus pneumoniae Rx1	52.294	69.872	0.365
ssbB/cilA	Streptococcus pneumoniae D39	52.294	69.872	0.365
ssbB/cilA	Streptococcus pneumoniae R6	52.294	69.872	0.365