Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | KJA90_RS01945 | Genome accession | NZ_OD940437 |
| Coordinates | 384283..384741 (+) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis isolate BX8117 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 375871..435016 | 384283..384741 | within | 0 |
Gene organization within MGE regions
Location: 375871..435016
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA90_RS01880 (BX8117_00380) | prgU | 376424..376780 (+) | 357 | WP_010714280.1 | pheromone response system RNA-binding regulator PrgU | - |
| KJA90_RS01885 (BX8117_00381) | - | 376883..377188 (+) | 306 | WP_224567327.1 | hypothetical protein | - |
| KJA90_RS01890 (BX8117_00382) | - | 377334..377594 (+) | 261 | WP_002370667.1 | hypothetical protein | - |
| KJA90_RS01895 (BX8117_00383) | - | 377605..378483 (+) | 879 | WP_002377931.1 | hypothetical protein | - |
| KJA90_RS01900 (BX8117_00384) | - | 378503..379363 (+) | 861 | WP_010710128.1 | LPXTG cell wall anchor domain-containing protein | - |
| KJA90_RS01905 (BX8117_00385) | - | 379389..380659 (+) | 1271 | Protein_355 | CHAP domain-containing protein | - |
| KJA90_RS01910 (BX8117_00386) | - | 380662..381279 (+) | 618 | WP_002377936.1 | hypothetical protein | - |
| KJA90_RS01915 (BX8117_00387) | - | 381263..381679 (+) | 417 | WP_002401419.1 | thioredoxin domain-containing protein | - |
| KJA90_RS01920 (BX8117_00388) | - | 381679..381993 (+) | 315 | WP_002360796.1 | hypothetical protein | - |
| KJA90_RS01925 (BX8117_00389) | - | 381986..383020 (+) | 1035 | WP_002403100.1 | conjugal transfer protein | - |
| KJA90_RS01930 (BX8117_00390) | - | 383025..383285 (+) | 261 | WP_010706916.1 | hypothetical protein | - |
| KJA90_RS01935 (BX8117_00391) | - | 383285..383674 (+) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| KJA90_RS01940 (BX8117_00392) | - | 383706..384188 (+) | 483 | WP_002377938.1 | hypothetical protein | - |
| KJA90_RS01945 (BX8117_00393) | ssb | 384283..384741 (+) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| KJA90_RS01950 (BX8117_00394) | - | 384846..387338 (+) | 2493 | WP_002377939.1 | ATP-binding protein | - |
| KJA90_RS01955 (BX8117_00395) | - | 387295..387693 (+) | 399 | WP_002370287.1 | DUF4923 family protein | - |
| KJA90_RS01960 (BX8117_00396) | - | 387706..390051 (+) | 2346 | WP_002377940.1 | MAEBL family membrane protein | - |
| KJA90_RS01965 (BX8117_00397) | - | 390038..392296 (+) | 2259 | WP_010710132.1 | TraM recognition domain-containing protein | - |
| KJA90_RS01970 (BX8117_00398) | - | 392819..393604 (+) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| KJA90_RS01975 (BX8117_00399) | - | 393610..394098 (+) | 489 | WP_010710133.1 | hypothetical protein | - |
| KJA90_RS01980 (BX8117_00400) | - | 394690..394956 (+) | 267 | WP_002377947.1 | hypothetical protein | - |
| KJA90_RS01985 (BX8117_00401) | - | 394989..395489 (+) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| KJA90_RS01990 (BX8117_00402) | - | 395502..395750 (+) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| KJA90_RS01995 (BX8117_00403) | - | 395826..396242 (+) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| KJA90_RS02000 (BX8117_00404) | - | 396266..396850 (+) | 585 | WP_002377949.1 | thermonuclease family protein | - |
| KJA90_RS02005 (BX8117_00405) | - | 396961..397227 (+) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| KJA90_RS02010 (BX8117_00406) | - | 397220..397495 (+) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| KJA90_RS02015 (BX8117_00407) | - | 397686..398330 (-) | 645 | WP_002377952.1 | IS6 family transposase | - |
| KJA90_RS02020 (BX8117_00408) | - | 398463..399345 (+) | 883 | Protein_378 | IS256 family transposase | - |
| KJA90_RS02025 (BX8117_00409) | - | 399650..400687 (-) | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| KJA90_RS02030 (BX8117_00410) | - | 400713..401651 (-) | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| KJA90_RS02035 (BX8117_00411) | - | 401779..402048 (-) | 270 | Protein_381 | LPXTG cell wall anchor domain-containing protein | - |
| KJA90_RS02040 (BX8117_00412) | - | 402138..402323 (+) | 186 | WP_002358660.1 | hypothetical protein | - |
| KJA90_RS02045 (BX8117_00413) | - | 402355..402963 (+) | 609 | Protein_383 | IS6 family transposase | - |
| KJA90_RS02050 (BX8117_00415) | bsh | 403632..404606 (-) | 975 | WP_002355428.1 | choloylglycine hydrolase | - |
| KJA90_RS02055 (BX8117_00416) | - | 404830..405474 (+) | 645 | WP_002377952.1 | IS6 family transposase | - |
| KJA90_RS02060 (BX8117_00417) | - | 405647..405961 (+) | 315 | WP_002403043.1 | hypothetical protein | - |
| KJA90_RS02065 (BX8117_00418) | cylR2 | 406299..406499 (-) | 201 | WP_002370931.1 | cytolysin regulator CylR2 | - |
| KJA90_RS02070 (BX8117_00420) | cylL-L | 406903..407109 (+) | 207 | WP_002358485.1 | lanthipeptide cytolysin subunit CylL-L | - |
| KJA90_RS02075 (BX8117_00421) | cylL-S | 407143..407334 (+) | 192 | WP_002358181.1 | lanthipeptide cytolysin subunit CylL-S | - |
| KJA90_RS02080 (BX8117_00422) | - | 407395..410376 (+) | 2982 | WP_002370929.1 | type 2 lanthipeptide synthetase LanM family protein | - |
| KJA90_RS02085 (BX8117_00423) | - | 410388..412532 (+) | 2145 | WP_002370927.1 | peptidase domain-containing ABC transporter | - |
| KJA90_RS02090 (BX8117_00424) | - | 412529..413767 (+) | 1239 | WP_002368283.1 | S8 family serine peptidase | - |
| KJA90_RS14625 (BX8117_00425) | - | 413768..414751 (+) | 984 | WP_002368282.1 | site-2 protease family protein | - |
| KJA90_RS02100 (BX8117_00426) | - | 415104..415667 (+) | 564 | WP_002370925.1 | hypothetical protein | - |
| KJA90_RS02105 (BX8117_00427) | - | 416104..416571 (+) | 468 | WP_002370921.1 | hypothetical protein | - |
| KJA90_RS02110 (BX8117_00428) | - | 416649..417230 (+) | 582 | WP_002401490.1 | hypothetical protein | - |
| KJA90_RS14630 | - | 417325..417531 (+) | 207 | WP_229017897.1 | S41 family peptidase | - |
| KJA90_RS02115 (BX8117_00429) | amaP | 417801..418367 (+) | 567 | WP_010706722.1 | alkaline shock response membrane anchor protein AmaP | - |
| KJA90_RS02120 (BX8117_00430) | - | 418384..418575 (+) | 192 | WP_002358517.1 | DUF2273 domain-containing protein | - |
| KJA90_RS02125 (BX8117_00431) | - | 418604..419140 (+) | 537 | WP_002358518.1 | Asp23/Gls24 family envelope stress response protein | - |
| KJA90_RS02130 (BX8117_00432) | - | 419415..425036 (+) | 5622 | WP_213044468.1 | Rib/alpha-like domain-containing protein | - |
| KJA90_RS02135 (BX8117_00433) | - | 425236..426444 (+) | 1209 | WP_002358521.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| KJA90_RS02140 (BX8117_00434) | - | 426574..426990 (+) | 417 | WP_002358522.1 | hypothetical protein | - |
| KJA90_RS02145 | - | 427126..427227 (-) | 102 | Protein_404 | IS30 family transposase | - |
| KJA90_RS02150 (BX8117_00436) | - | 427215..427952 (+) | 738 | WP_002401428.1 | hypothetical protein | - |
| KJA90_RS02155 (BX8117_00437) | - | 427998..428618 (-) | 621 | WP_143341923.1 | recombinase family protein | - |
| KJA90_RS02160 (BX8117_00438) | - | 428802..429421 (+) | 620 | Protein_407 | recombinase family protein | - |
| KJA90_RS02165 | - | 429530..429712 (+) | 183 | WP_002358529.1 | hypothetical protein | - |
| KJA90_RS02170 (BX8117_00439) | - | 430168..430986 (-) | 819 | WP_002358531.1 | MurR/RpiR family transcriptional regulator | - |
| KJA90_RS02175 (BX8117_00440) | - | 431142..431849 (+) | 708 | WP_002358533.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| KJA90_RS02180 (BX8117_00441) | - | 431842..433344 (+) | 1503 | WP_002358534.1 | PTS transporter subunit EIIC | - |
| KJA90_RS02185 (BX8117_00442) | - | 433355..433837 (+) | 483 | WP_002358535.1 | PTS glucose transporter subunit IIA | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=1150713 KJA90_RS01945 WP_002365911.1 384283..384741(+) (ssb) [Enterococcus faecalis isolate BX8117]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=1150713 KJA90_RS01945 WP_002365911.1 384283..384741(+) (ssb) [Enterococcus faecalis isolate BX8117]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |