Detailed information NTG1150456

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: DYY93_RS13195
• Genome accession: NZ_LT996889
• Coordinates: 2555553..2555864 (+)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus isolate 24117-REV
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2550553..2560864

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DYY93_RS13170	-	2550608..2550937 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
DYY93_RS13175	-	2550934..2551557 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
DYY93_RS13180	-	2551852..2553498 (+)	1647	WP_000277718.1	IS1182 family transposase	-
DYY93_RS13185	comGA	2553523..2554497 (+)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
DYY93_RS13190	comGB	2554469..2555539 (+)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
DYY93_RS13195	comGC	2555553..2555864 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
DYY93_RS13200	comGD	2555842..2556288 (+)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
DYY93_RS13205	comGE	2556275..2556574 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
DYY93_RS13210	comGF	2556492..2556989 (+)	498	WP_029642894.1	competence type IV pilus minor pilin ComGF	Machinery gene
DYY93_RS13215	-	2557086..2557232 (+)	147	WP_001789879.1	hypothetical protein	-
DYY93_RS13220	-	2557222..2557746 (+)	525	WP_001015123.1	shikimate kinase	-
DYY93_RS13225	gcvT	2557905..2558996 (+)	1092	WP_000093348.1	glycine cleavage system aminomethyltransferase GcvT	-
DYY93_RS13230	gcvPA	2559016..2560362 (+)	1347	WP_000019689.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=1150456 DYY93_RS13195 WP_000472256.1 2555553..2555864(+) (comGC) [Staphylococcus aureus isolate 24117-REV]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=1150456 DYY93_RS13195 WP_000472256.1 2555553..2555864(+) (comGC) [Staphylococcus aureus isolate 24117-REV]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369