Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | EDCC5055_RS07875 | Genome accession | NZ_LT671859 |
| Coordinates | 1567461..1567772 (-) | Length | 103 a.a. |
| NCBI ID | WP_073546256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus isolate Clinical isolate | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1562461..1572772
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EDCC5055_RS07840 (EDCC5055_01458) | gcvPA | 1562963..1564309 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| EDCC5055_RS07845 (EDCC5055_01459) | gcvT | 1564329..1565420 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| EDCC5055_RS07850 (EDCC5055_01461) | - | 1565579..1566103 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| EDCC5055_RS07855 | - | 1566093..1566239 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| EDCC5055_RS07860 (EDCC5055_01462) | comGF | 1566336..1566833 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| EDCC5055_RS07865 (EDCC5055_01463) | comGE | 1566751..1567050 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| EDCC5055_RS07870 (EDCC5055_01464) | comGD | 1567037..1567483 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| EDCC5055_RS07875 (EDCC5055_01465) | comGC | 1567461..1567772 (-) | 312 | WP_073546256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| EDCC5055_RS07880 (EDCC5055_01466) | comGB | 1567786..1568856 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| EDCC5055_RS07885 (EDCC5055_01467) | comGA | 1568828..1569802 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| EDCC5055_RS07890 (EDCC5055_01468) | - | 1569854..1570477 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| EDCC5055_RS07895 (EDCC5055_01469) | - | 1570474..1570803 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| EDCC5055_RS07900 (EDCC5055_01470) | - | 1570803..1571789 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| EDCC5055_RS07905 | - | 1571786..1571989 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11357.44 Da Isoelectric Point: 8.5268
>NTDB_id=1146042 EDCC5055_RS07875 WP_073546256.1 1567461..1567772(-) (comGC) [Staphylococcus aureus isolate Clinical isolate]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADVFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADVFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=1146042 EDCC5055_RS07875 WP_073546256.1 1567461..1567772(-) (comGC) [Staphylococcus aureus isolate Clinical isolate]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGTTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGTTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
99.029 |
100 |
0.99 |
| comGC | Staphylococcus aureus MW2 |
99.029 |
100 |
0.99 |
| comGC/cglC | Streptococcus mitis SK321 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
45.098 |
99.029 |
0.447 |
| comGC/cglC | Streptococcus pneumoniae R6 |
45.098 |
99.029 |
0.447 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
45.098 |
99.029 |
0.447 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
45.098 |
99.029 |
0.447 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
50 |
83.495 |
0.417 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
41.837 |
95.146 |
0.398 |
| comYC | Streptococcus suis isolate S10 |
48.718 |
75.728 |
0.369 |