Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | BN3853_RS06590 | Genome accession | NZ_LT220504 |
| Coordinates | 1421823..1422260 (-) | Length | 145 a.a. |
| NCBI ID | WP_061713680.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus rhamnosus strain BPL5 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1390108..1432286 | 1421823..1422260 | within | 0 |
Gene organization within MGE regions
Location: 1390108..1432286
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN3853_RS06395 | - | 1390108..1391406 (-) | 1299 | WP_061713662.1 | LysM peptidoglycan-binding domain-containing protein | - |
| BN3853_RS06400 | - | 1391417..1391830 (-) | 414 | WP_005714728.1 | phage holin | - |
| BN3853_RS06405 | - | 1391845..1392144 (-) | 300 | WP_012491468.1 | hypothetical protein | - |
| BN3853_RS14695 | - | 1392176..1392319 (-) | 144 | WP_005688592.1 | XkdX family protein | - |
| BN3853_RS06410 | - | 1392316..1392645 (-) | 330 | WP_005711092.1 | hypothetical protein | - |
| BN3853_RS06415 | - | 1392661..1395615 (-) | 2955 | WP_049152773.1 | phage tail protein | - |
| BN3853_RS06420 | - | 1395616..1397547 (-) | 1932 | WP_061713663.1 | distal tail protein Dit | - |
| BN3853_RS06425 | - | 1397548..1402401 (-) | 4854 | WP_061713664.1 | phage tail tape measure protein | - |
| BN3853_RS06430 | gpG | 1402524..1402937 (-) | 414 | WP_049152776.1 | phage tail assembly chaperone G | - |
| BN3853_RS06435 | - | 1403011..1403196 (-) | 186 | WP_032953809.1 | Ig-like domain-containing protein | - |
| BN3853_RS06440 | - | 1403253..1403861 (-) | 609 | WP_005688578.1 | major tail protein | - |
| BN3853_RS06445 | - | 1403895..1404281 (-) | 387 | WP_061713665.1 | hypothetical protein | - |
| BN3853_RS06450 | - | 1404281..1404667 (-) | 387 | WP_049173127.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| BN3853_RS06455 | - | 1404667..1404996 (-) | 330 | WP_020752182.1 | head-tail adaptor protein | - |
| BN3853_RS06460 | - | 1404986..1405345 (-) | 360 | WP_003564855.1 | head-tail connector protein | - |
| BN3853_RS06465 | - | 1405356..1405595 (-) | 240 | WP_005712764.1 | Ig-like domain-containing protein | - |
| BN3853_RS06470 | - | 1405613..1406815 (-) | 1203 | WP_061713666.1 | phage major capsid protein | - |
| BN3853_RS06475 | - | 1406857..1407486 (-) | 630 | WP_032953808.1 | HK97 family phage prohead protease | - |
| BN3853_RS06480 | - | 1407440..1408693 (-) | 1254 | WP_005688565.1 | phage portal protein | - |
| BN3853_RS06485 | - | 1408699..1408890 (-) | 192 | WP_003661399.1 | hypothetical protein | - |
| BN3853_RS06490 | - | 1408902..1410614 (-) | 1713 | WP_032953807.1 | terminase large subunit | - |
| BN3853_RS06495 | - | 1410636..1411091 (-) | 456 | WP_061713667.1 | P27 family phage terminase small subunit | - |
| BN3853_RS06500 | - | 1411287..1412096 (-) | 810 | WP_005688561.1 | HNH endonuclease | - |
| BN3853_RS15415 | - | 1412133..1412354 (-) | 222 | WP_139552859.1 | hypothetical protein | - |
| BN3853_RS06505 | - | 1412299..1412622 (-) | 324 | WP_049152782.1 | ribonucleoside-diphosphate reductase | - |
| BN3853_RS06510 | - | 1413276..1413884 (-) | 609 | WP_061713668.1 | DUF4145 domain-containing protein | - |
| BN3853_RS06515 | - | 1414180..1414608 (-) | 429 | WP_015992527.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BN3853_RS06520 | - | 1415008..1415190 (-) | 183 | WP_061713669.1 | hypothetical protein | - |
| BN3853_RS06525 | - | 1415187..1415555 (-) | 369 | WP_061713670.1 | YopX family protein | - |
| BN3853_RS06530 | - | 1415552..1415881 (-) | 330 | WP_061713671.1 | hypothetical protein | - |
| BN3853_RS06535 | - | 1415871..1416089 (-) | 219 | WP_061713672.1 | hypothetical protein | - |
| BN3853_RS06540 | - | 1416076..1416255 (-) | 180 | WP_061713673.1 | hypothetical protein | - |
| BN3853_RS06545 | - | 1416245..1416787 (-) | 543 | WP_061713674.1 | DUF1642 domain-containing protein | - |
| BN3853_RS15860 | - | 1416784..1416909 (-) | 126 | WP_032964560.1 | hypothetical protein | - |
| BN3853_RS06550 | - | 1416906..1417613 (-) | 708 | WP_032964563.1 | N-6 DNA methylase | - |
| BN3853_RS06555 | - | 1417606..1418457 (-) | 852 | WP_032964565.1 | DNA cytosine methyltransferase | - |
| BN3853_RS06560 | - | 1418471..1418836 (-) | 366 | WP_003607027.1 | endodeoxyribonuclease | - |
| BN3853_RS06565 | - | 1418833..1419087 (-) | 255 | WP_061713675.1 | hypothetical protein | - |
| BN3853_RS06570 | - | 1419074..1419361 (-) | 288 | WP_061713676.1 | helix-turn-helix domain-containing protein | - |
| BN3853_RS06575 | - | 1419374..1419718 (-) | 345 | WP_061713677.1 | hypothetical protein | - |
| BN3853_RS06580 | - | 1419720..1420982 (-) | 1263 | WP_061713678.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| BN3853_RS06585 | - | 1420979..1421806 (-) | 828 | WP_061713679.1 | helix-turn-helix domain-containing protein | - |
| BN3853_RS06590 | ssb | 1421823..1422260 (-) | 438 | WP_061713680.1 | single-stranded DNA-binding protein | Machinery gene |
| BN3853_RS06595 | - | 1422275..1422943 (-) | 669 | WP_081014197.1 | putative HNHc nuclease | - |
| BN3853_RS06600 | - | 1422918..1423634 (-) | 717 | WP_061713681.1 | ERF family protein | - |
| BN3853_RS06605 | - | 1423646..1424137 (-) | 492 | WP_061713682.1 | siphovirus Gp157 family protein | - |
| BN3853_RS06610 | - | 1424155..1424358 (-) | 204 | WP_061713786.1 | hypothetical protein | - |
| BN3853_RS15655 | - | 1424363..1424515 (-) | 153 | WP_172794427.1 | hypothetical protein | - |
| BN3853_RS15865 | - | 1424508..1424636 (-) | 129 | WP_016363220.1 | hypothetical protein | - |
| BN3853_RS06615 | - | 1424636..1424992 (-) | 357 | WP_061713683.1 | DUF771 domain-containing protein | - |
| BN3853_RS06620 | - | 1425057..1425647 (+) | 591 | WP_061713684.1 | hypothetical protein | - |
| BN3853_RS06625 | - | 1425899..1426672 (-) | 774 | WP_061713685.1 | phage antirepressor | - |
| BN3853_RS06630 | - | 1426675..1426917 (-) | 243 | WP_003579424.1 | hypothetical protein | - |
| BN3853_RS14705 | - | 1427159..1427512 (+) | 354 | WP_072137654.1 | helix-turn-helix domain-containing protein | - |
| BN3853_RS06635 | - | 1427505..1427927 (+) | 423 | WP_048487208.1 | ImmA/IrrE family metallo-endopeptidase | - |
| BN3853_RS15740 | - | 1428002..1428787 (+) | 786 | WP_061713686.1 | Ltp family lipoprotein | - |
| BN3853_RS06645 | - | 1428869..1429666 (+) | 798 | WP_048487203.1 | SHOCT domain-containing protein | - |
| BN3853_RS06650 | - | 1429907..1430287 (+) | 381 | WP_061713687.1 | hypothetical protein | - |
| BN3853_RS15795 | - | 1430280..1430690 (+) | 411 | WP_225358113.1 | hypothetical protein | - |
| BN3853_RS06660 | - | 1430788..1431051 (+) | 264 | WP_032957376.1 | hypothetical protein | - |
| BN3853_RS06665 | - | 1431159..1432286 (+) | 1128 | WP_049152798.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 15888.37 Da Isoelectric Point: 4.8780
>NTDB_id=1143623 BN3853_RS06590 WP_061713680.1 1421823..1422260(-) (ssb) [Lacticaseibacillus rhamnosus strain BPL5]
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGNRETDFISCAIWRKSAENLAKFTHKGSLIGVEGHVQTR
TYDNAQGNKVYVTEVIVDNFALLEPRQTSQDSQQRSSNNPAAASEDNGFANNSQPVDVSDDDLPF
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGNRETDFISCAIWRKSAENLAKFTHKGSLIGVEGHVQTR
TYDNAQGNKVYVTEVIVDNFALLEPRQTSQDSQQRSSNNPAAASEDNGFANNSQPVDVSDDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=1143623 BN3853_RS06590 WP_061713680.1 1421823..1422260(-) (ssb) [Lacticaseibacillus rhamnosus strain BPL5]
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTCGG
CTCATTCACAATCGCTGTTGACCGTCAATTCCGCAGTGCTAATGGCAACCGGGAGACTGACTTCATCAGTTGTGCTATCT
GGCGCAAGTCAGCTGAGAACCTCGCTAAGTTCACGCATAAGGGTTCGCTCATTGGTGTCGAAGGTCATGTCCAGACACGC
ACATACGACAACGCACAAGGTAATAAGGTGTACGTGACTGAGGTGATCGTTGATAATTTCGCCTTGCTTGAGCCGCGGCA
GACGTCTCAGGACAGCCAACAGCGATCGTCTAATAACCCAGCGGCCGCAAGCGAAGACAATGGTTTTGCTAACAATAGCC
AGCCAGTCGATGTCAGCGATGATGATCTTCCATTCTAA
ATGCTTAATTCAGTTGCTTTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACGGCAGTCGG
CTCATTCACAATCGCTGTTGACCGTCAATTCCGCAGTGCTAATGGCAACCGGGAGACTGACTTCATCAGTTGTGCTATCT
GGCGCAAGTCAGCTGAGAACCTCGCTAAGTTCACGCATAAGGGTTCGCTCATTGGTGTCGAAGGTCATGTCCAGACACGC
ACATACGACAACGCACAAGGTAATAAGGTGTACGTGACTGAGGTGATCGTTGATAATTTCGCCTTGCTTGAGCCGCGGCA
GACGTCTCAGGACAGCCAACAGCGATCGTCTAATAACCCAGCGGCCGCAAGCGAAGACAATGGTTTTGCTAACAATAGCC
AGCCAGTCGATGTCAGCGATGATGATCTTCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.648 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
44 |
100 |
0.531 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.041 |
100 |
0.393 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
39.041 |
100 |
0.393 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
52.83 |
73.103 |
0.386 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
38.356 |
100 |
0.386 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
38.356 |
100 |
0.386 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
38.356 |
100 |
0.386 |
| ssbB/cilA | Streptococcus mitis SK321 |
38.356 |
100 |
0.386 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
36.552 |
100 |
0.366 |