Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | DQL39_RS03140 | Genome accession | NZ_LS483353 |
| Coordinates | 596035..596526 (+) | Length | 163 a.a. |
| NCBI ID | WP_038433322.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NCTC4001 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 585358..633401 | 596035..596526 | within | 0 |
Gene organization within MGE regions
Location: 585358..633401
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL39_RS03050 (NCTC4001_00608) | - | 585358..585978 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| DQL39_RS03055 (NCTC4001_00609) | - | 586342..587430 (-) | 1089 | WP_038433317.1 | site-specific integrase | - |
| DQL39_RS03060 (NCTC4001_00611) | - | 587680..588489 (-) | 810 | WP_002984270.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DQL39_RS03065 (NCTC4001_00612) | - | 588502..589326 (-) | 825 | WP_038433318.1 | XRE family transcriptional regulator | - |
| DQL39_RS03070 (NCTC4001_00614) | - | 589817..590032 (-) | 216 | WP_021341080.1 | hypothetical protein | - |
| DQL39_RS03075 (NCTC4001_00615) | - | 590091..590249 (+) | 159 | WP_080286776.1 | hypothetical protein | - |
| DQL39_RS03080 (NCTC4001_00616) | - | 590348..590989 (-) | 642 | WP_001008979.1 | hypothetical protein | - |
| DQL39_RS03085 (NCTC4001_00617) | - | 591041..591241 (+) | 201 | WP_038433319.1 | helix-turn-helix domain-containing protein | - |
| DQL39_RS03090 (NCTC4001_00618) | - | 591372..591611 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| DQL39_RS03095 (NCTC4001_00619) | - | 591778..591963 (+) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| DQL39_RS03100 (NCTC4001_00620) | - | 592042..592338 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| DQL39_RS09250 (NCTC4001_00621) | - | 592335..592469 (+) | 135 | WP_002995985.1 | hypothetical protein | - |
| DQL39_RS03105 (NCTC4001_00622) | - | 592485..592799 (+) | 315 | WP_023610888.1 | helix-turn-helix domain-containing protein | - |
| DQL39_RS03110 (NCTC4001_00623) | - | 592813..593643 (+) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| DQL39_RS03115 (NCTC4001_00624) | - | 593630..594223 (+) | 594 | Protein_571 | ATP-binding protein | - |
| DQL39_RS03120 (NCTC4001_00625) | - | 594275..594628 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| DQL39_RS03125 (NCTC4001_00626) | - | 594609..594863 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| DQL39_RS03130 (NCTC4001_00627) | - | 594885..595367 (+) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| DQL39_RS03135 (NCTC4001_00628) | - | 595368..596042 (+) | 675 | WP_038433320.1 | ERF family protein | - |
| DQL39_RS03140 (NCTC4001_00629) | ssb | 596035..596526 (+) | 492 | WP_038433322.1 | single-stranded DNA-binding protein | Machinery gene |
| DQL39_RS03145 | - | 596532..596735 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| DQL39_RS03150 (NCTC4001_00630) | - | 596735..597175 (+) | 441 | WP_011018139.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DQL39_RS03155 (NCTC4001_00631) | - | 597172..597528 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| DQL39_RS09280 (NCTC4001_00632) | - | 597525..597776 (+) | 252 | WP_111718061.1 | hypothetical protein | - |
| DQL39_RS03165 (NCTC4001_00633) | - | 597770..598054 (+) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| DQL39_RS03170 (NCTC4001_00634) | - | 598051..598320 (+) | 270 | WP_038433325.1 | hypothetical protein | - |
| DQL39_RS03175 (NCTC4001_00635) | - | 598301..598720 (+) | 420 | WP_409327382.1 | YopX family protein | - |
| DQL39_RS03180 (NCTC4001_00636) | - | 598717..599001 (+) | 285 | WP_011017570.1 | hypothetical protein | - |
| DQL39_RS03185 (NCTC4001_00637) | - | 599005..599490 (+) | 486 | WP_111703186.1 | class I SAM-dependent methyltransferase | - |
| DQL39_RS03190 (NCTC4001_00638) | - | 599494..599721 (+) | 228 | WP_021340166.1 | hypothetical protein | - |
| DQL39_RS03195 (NCTC4001_00639) | - | 599746..599931 (+) | 186 | WP_011054812.1 | hypothetical protein | - |
| DQL39_RS03200 (NCTC4001_00640) | - | 600218..600721 (+) | 504 | WP_032461638.1 | DUF1642 domain-containing protein | - |
| DQL39_RS03205 (NCTC4001_00642) | - | 601171..601605 (+) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DQL39_RS03210 (NCTC4001_00643) | - | 602198..602539 (+) | 342 | WP_021340284.1 | HNH endonuclease | - |
| DQL39_RS03215 (NCTC4001_00644) | - | 602707..603174 (+) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| DQL39_RS03220 (NCTC4001_00645) | - | 603189..604943 (+) | 1755 | WP_032461635.1 | terminase large subunit | - |
| DQL39_RS09050 (NCTC4001_00646) | - | 604940..605110 (+) | 171 | WP_002985365.1 | hypothetical protein | - |
| DQL39_RS03225 (NCTC4001_00647) | - | 605103..605327 (+) | 225 | WP_002985363.1 | hypothetical protein | - |
| DQL39_RS03230 (NCTC4001_00648) | - | 605361..606581 (+) | 1221 | WP_038433129.1 | phage portal protein | - |
| DQL39_RS03235 (NCTC4001_00649) | - | 606559..607224 (+) | 666 | WP_021341143.1 | head maturation protease, ClpP-related | - |
| DQL39_RS03240 (NCTC4001_00650) | - | 607248..608432 (+) | 1185 | WP_029714355.1 | phage major capsid protein | - |
| DQL39_RS09255 | - | 608446..608574 (+) | 129 | WP_021341089.1 | hypothetical protein | - |
| DQL39_RS03245 (NCTC4001_00651) | - | 608577..608879 (+) | 303 | WP_021341088.1 | head-tail connector protein | - |
| DQL39_RS03250 (NCTC4001_00652) | - | 608876..609223 (+) | 348 | WP_029714354.1 | phage head closure protein | - |
| DQL39_RS03255 (NCTC4001_00653) | - | 609220..609597 (+) | 378 | WP_021340627.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DQL39_RS03260 (NCTC4001_00654) | - | 609594..610019 (+) | 426 | WP_021341057.1 | hypothetical protein | - |
| DQL39_RS03265 (NCTC4001_00655) | - | 610036..610647 (+) | 612 | WP_021341058.1 | major tail protein | - |
| DQL39_RS03270 (NCTC4001_00656) | gpG | 610700..611026 (+) | 327 | WP_021733367.1 | phage tail assembly chaperone G | - |
| DQL39_RS09055 | - | 611074..611223 (+) | 150 | WP_021299462.1 | hypothetical protein | - |
| DQL39_RS03275 (NCTC4001_00657) | - | 611236..615159 (+) | 3924 | WP_111718062.1 | phage tail tape measure protein | - |
| DQL39_RS03280 (NCTC4001_00658) | - | 615159..615866 (+) | 708 | WP_024623478.1 | distal tail protein Dit | - |
| DQL39_RS03285 (NCTC4001_00659) | - | 615863..618007 (+) | 2145 | WP_111718063.1 | phage tail spike protein | - |
| DQL39_RS03290 (NCTC4001_00660) | - | 618004..619008 (+) | 1005 | WP_038433336.1 | hyaluronoglucosaminidase | - |
| DQL39_RS03295 (NCTC4001_00661) | - | 619024..620979 (+) | 1956 | WP_172450307.1 | gp58-like family protein | - |
| DQL39_RS03300 (NCTC4001_00662) | - | 621056..621217 (+) | 162 | WP_002987333.1 | hypothetical protein | - |
| DQL39_RS03305 (NCTC4001_00663) | - | 621220..621831 (+) | 612 | WP_038433337.1 | DUF1366 domain-containing protein | - |
| DQL39_RS03310 (NCTC4001_00664) | - | 621847..622122 (+) | 276 | WP_002987582.1 | hypothetical protein | - |
| DQL39_RS03315 (NCTC4001_00665) | - | 622119..622346 (+) | 228 | WP_000609113.1 | phage holin | - |
| DQL39_RS03320 (NCTC4001_00666) | - | 622472..623800 (+) | 1329 | WP_038433339.1 | GH25 family lysozyme | - |
| DQL39_RS03325 (NCTC4001_00667) | - | 623879..624319 (-) | 441 | WP_038433341.1 | hypothetical protein | - |
| DQL39_RS03330 (NCTC4001_00668) | sda3 | 624591..625391 (-) | 801 | WP_162472510.1 | streptodornase Sda3 | - |
| DQL39_RS03335 (NCTC4001_00669) | prx | 625629..625817 (+) | 189 | WP_032461628.1 | hypothetical protein | Regulator |
| DQL39_RS03345 (NCTC4001_00671) | - | 626408..627022 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| DQL39_RS03350 (NCTC4001_00672) | - | 627149..627934 (-) | 786 | WP_038433345.1 | hypothetical protein | - |
| DQL39_RS03355 (NCTC4001_00673) | - | 627944..628642 (-) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| DQL39_RS03360 (NCTC4001_00674) | - | 628642..629013 (-) | 372 | WP_038433347.1 | GntR family transcriptional regulator | - |
| DQL39_RS03365 (NCTC4001_00675) | - | 629198..632308 (+) | 3111 | WP_038433348.1 | DNA polymerase III subunit alpha | - |
| DQL39_RS03370 (NCTC4001_00676) | pfkA | 632388..633401 (+) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
Sequence
Protein
Download Length: 163 a.a. Molecular weight: 18082.91 Da Isoelectric Point: 4.9332
>NTDB_id=1138091 DQL39_RS03140 WP_038433322.1 596035..596526(+) (ssb) [Streptococcus pyogenes strain NCTC4001]
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVAENFQMLESRATREGGLTGSFNGGFNNNTSSSNSYSAPAQQTPNFGRDDSPFGNSNPMDISDDD
LPF
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVAENFQMLESRATREGGLTGSFNGGFNNNTSSSNSYSAPAQQTPNFGRDDSPFGNSNPMDISDDD
LPF
Nucleotide
Download Length: 492 bp
>NTDB_id=1138091 DQL39_RS03140 WP_038433322.1 596035..596526(+) (ssb) [Streptococcus pyogenes strain NCTC4001]
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAACTTCCAAATGTTGGAAAGTCGTGC
TACACGTGAAGGTGGCTTAACTGGCTCATTTAATGGTGGTTTTAACAATAACACTTCATCATCAAACAGTTACTCAGCGC
CTGCACAACAAACGCCTAACTTTGGAAGAGATGATAGCCCATTTGGCAATTCAAACCCAATGGATATTTCAGACGATGAT
CTGCCGTTTTAA
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAACTTCCAAATGTTGGAAAGTCGTGC
TACACGTGAAGGTGGCTTAACTGGCTCATTTAATGGTGGTTTTAACAATAACACTTCATCATCAAACAGTTACTCAGCGC
CTGCACAACAAACGCCTAACTTTGGAAGAGATGATAGCCCATTTGGCAATTCAAACCCAATGGATATTTCAGACGATGAT
CTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
59.302 |
100 |
0.626 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.143 |
100 |
0.613 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
65.031 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
55.046 |
66.871 |
0.368 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
54.128 |
66.871 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
54.128 |
66.871 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
54.128 |
66.871 |
0.362 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
54.128 |
66.871 |
0.362 |
| ssbB/cilA | Streptococcus mitis SK321 |
54.128 |
66.871 |
0.362 |