Detailed information NTG1115832

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: E0E15_RS08250
• Genome accession: NZ_LR027870
• Coordinates: 1632504..1632815 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain BPH2019 isolate BPH2019
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	1632984..1634156	1632504..1632815	flank	169

Gene organization within MGE regions

Location: 1632504..1634156

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
E0E15_RS08250	comGC	1632504..1632815 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
E0E15_RS08260	-	1632984..1634156 (+)	1173	WP_000195429.1	IS256-like element IS256 family transposase	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=1115832 E0E15_RS08250 WP_000472256.1 1632504..1632815(-) (comGC) [Staphylococcus aureus strain BPH2019 isolate BPH2019]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=1115832 E0E15_RS08250 WP_000472256.1 1632504..1632815(-) (comGC) [Staphylococcus aureus strain BPH2019 isolate BPH2019]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369