Detailed information
Bioinformatically predicted
Overview
| Name | comC | Type | Regulator |
| Locus tag | ACN076_RS01300 | Genome accession | NZ_CP184836 |
| Coordinates | 232055..232177 (+) | Length | 40 a.a. |
| NCBI ID | WP_153193936.1 | Uniprot ID | - |
| Organism | Streptococcus sp. K0074 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 227055..237177
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACN076_RS01275 (ACN076_01275) | dnaA | 227540..228901 (-) | 1362 | WP_023944973.1 | chromosomal replication initiator protein DnaA | - |
| ACN076_RS01280 (ACN076_01280) | spo0J | 229114..229872 (-) | 759 | WP_420789998.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| ACN076_RS01285 (ACN076_01285) | htrA | 229930..231111 (-) | 1182 | WP_420789999.1 | S1C family serine protease | Regulator |
| ACN076_RS01290 (ACN076_01290) | rlmH | 231294..231773 (+) | 480 | WP_153193935.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| ACN076_RS01300 (ACN076_01300) | comC | 232055..232177 (+) | 123 | WP_153193936.1 | competence-stimulating peptide ComC | Regulator |
| ACN076_RS01305 (ACN076_01305) | comD/comD2 | 232190..233515 (+) | 1326 | WP_153193937.1 | competence system sensor histidine kinase ComD | Regulator |
| ACN076_RS01310 (ACN076_01310) | comE | 233512..234264 (+) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| ACN076_RS01325 (ACN076_01325) | - | 234507..235049 (-) | 543 | WP_049524461.1 | TetR/AcrR family transcriptional regulator | - |
Sequence
Protein
Download Length: 40 a.a. Molecular weight: 4781.64 Da Isoelectric Point: 11.0006
>NTDB_id=1111422 ACN076_RS01300 WP_153193936.1 232055..232177(+) (comC) [Streptococcus sp. K0074]
MKNTVKLEQFVDLKEKDLQKIKGGEIRKTSNSLLNFFKRR
MKNTVKLEQFVDLKEKDLQKIKGGEIRKTSNSLLNFFKRR
Nucleotide
Download Length: 123 bp
>NTDB_id=1111422 ACN076_RS01300 WP_153193936.1 232055..232177(+) (comC) [Streptococcus sp. K0074]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGACTTGAAGGAAAAAGACTTGCAAAAGATTAAAGGTGGGGAAATAAG
AAAAACAAGTAATAGTTTACTTAATTTCTTTAAAAGAAGATAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGACTTGAAGGAAAAAGACTTGCAAAAGATTAAAGGTGGGGAAATAAG
AAAAACAAGTAATAGTTTACTTAATTTCTTTAAAAGAAGATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC | Streptococcus mitis NCTC 12261 |
72.5 |
100 |
0.725 |
| comC/comC2 | Streptococcus pneumoniae A66 |
75.676 |
92.5 |
0.7 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
75.676 |
92.5 |
0.7 |
| comC/comC1 | Streptococcus pneumoniae R6 |
92.593 |
67.5 |
0.625 |
| comC/comC1 | Streptococcus pneumoniae G54 |
92.593 |
67.5 |
0.625 |
| comC/comC1 | Streptococcus pneumoniae D39 |
92.593 |
67.5 |
0.625 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
92.593 |
67.5 |
0.625 |
| comC | Streptococcus mitis SK321 |
85.185 |
67.5 |
0.575 |
| comC/comC2 | Streptococcus gordonii strain NCTC7865 |
40.541 |
92.5 |
0.375 |