Detailed information
Bioinformatically predicted
Overview
| Name | Cj0011c | Type | Machinery gene |
| Locus tag | ACLHDE_RS03685 | Genome accession | NZ_CP180409 |
| Coordinates | 733816..734064 (+) | Length | 82 a.a. |
| NCBI ID | WP_415397862.1 | Uniprot ID | - |
| Organism | Sulfurimonas sp. CS5 | ||
| Function | DNA binding (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 734353..754272 | 733816..734064 | flank | 289 |
Gene organization within MGE regions
Location: 733816..754272
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACLHDE_RS03685 (ACLHDE_03685) | Cj0011c | 733816..734064 (+) | 249 | WP_415397862.1 | ComEA family DNA-binding protein | Machinery gene |
| ACLHDE_RS03690 (ACLHDE_03690) | rfbA | 734353..735222 (+) | 870 | WP_415397863.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| ACLHDE_RS03695 (ACLHDE_03695) | rfbB | 735215..736228 (+) | 1014 | WP_415397864.1 | dTDP-glucose 4,6-dehydratase | - |
| ACLHDE_RS03700 (ACLHDE_03700) | - | 736225..736620 (+) | 396 | WP_415397865.1 | sugar 3,4-ketoisomerase | - |
| ACLHDE_RS03705 (ACLHDE_03705) | - | 736620..737135 (+) | 516 | WP_415397866.1 | DapH/DapD/GlmU-related protein | - |
| ACLHDE_RS03710 (ACLHDE_03710) | - | 737132..738232 (+) | 1101 | WP_415397867.1 | DegT/DnrJ/EryC1/StrS family aminotransferase | - |
| ACLHDE_RS03715 (ACLHDE_03715) | - | 738219..739460 (+) | 1242 | WP_415397868.1 | hypothetical protein | - |
| ACLHDE_RS03720 (ACLHDE_03720) | - | 739435..741165 (+) | 1731 | WP_415397869.1 | ATP-binding cassette domain-containing protein | - |
| ACLHDE_RS03725 (ACLHDE_03725) | - | 741152..741913 (+) | 762 | WP_415397870.1 | HpcH/HpaI aldolase family protein | - |
| ACLHDE_RS03730 (ACLHDE_03730) | - | 741913..742683 (+) | 771 | WP_415397871.1 | 3-deoxy-manno-octulosonate cytidylyltransferase | - |
| ACLHDE_RS03735 (ACLHDE_03735) | - | 742683..744524 (+) | 1842 | WP_415397872.1 | carbamoyltransferase | - |
| ACLHDE_RS03740 (ACLHDE_03740) | - | 744517..745551 (+) | 1035 | WP_415397873.1 | hypothetical protein | - |
| ACLHDE_RS03745 (ACLHDE_03745) | - | 745669..746646 (+) | 978 | WP_415397874.1 | class I SAM-dependent methyltransferase | - |
| ACLHDE_RS03750 (ACLHDE_03750) | - | 746648..747577 (+) | 930 | WP_415397875.1 | phosphoglycerate dehydrogenase | - |
| ACLHDE_RS03755 (ACLHDE_03755) | - | 747574..748485 (+) | 912 | WP_415397876.1 | hypothetical protein | - |
| ACLHDE_RS03760 (ACLHDE_03760) | - | 748482..749060 (+) | 579 | WP_415397877.1 | SIS domain-containing protein | - |
| ACLHDE_RS03765 (ACLHDE_03765) | - | 749057..750067 (+) | 1011 | WP_415397878.1 | Gfo/Idh/MocA family protein | - |
| ACLHDE_RS03770 (ACLHDE_03770) | - | 750057..750722 (+) | 666 | WP_415397879.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| ACLHDE_RS03775 (ACLHDE_03775) | - | 750719..751795 (+) | 1077 | WP_415397880.1 | AroB-related putative sugar phosphate phospholyase (cyclizing) | - |
| ACLHDE_RS03780 (ACLHDE_03780) | - | 751800..752471 (+) | 672 | WP_415397881.1 | cyclase family protein | - |
| ACLHDE_RS03785 (ACLHDE_03785) | - | 752464..753480 (+) | 1017 | WP_415397882.1 | sulfotransferase | - |
| ACLHDE_RS03790 (ACLHDE_03790) | rfbF | 753493..754272 (+) | 780 | WP_415397883.1 | glucose-1-phosphate cytidylyltransferase | - |
Sequence
Protein
Download Length: 82 a.a. Molecular weight: 8792.50 Da Isoelectric Point: 10.5787
>NTDB_id=1095734 ACLHDE_RS03685 WP_415397862.1 733816..734064(+) (Cj0011c) [Sulfurimonas sp. CS5]
MKFFVIIALGVSLLFGAVDINTASKKELSSLNGIGSTKAEAIIVYRKANCFKNVKELAKVKGIGKKTVEKNMSDLSASPC
KK
MKFFVIIALGVSLLFGAVDINTASKKELSSLNGIGSTKAEAIIVYRKANCFKNVKELAKVKGIGKKTVEKNMSDLSASPC
KK
Nucleotide
Download Length: 249 bp
>NTDB_id=1095734 ACLHDE_RS03685 WP_415397862.1 733816..734064(+) (Cj0011c) [Sulfurimonas sp. CS5]
ATGAAGTTTTTTGTGATTATTGCGCTAGGAGTTAGTTTATTGTTTGGTGCTGTTGATATTAACACTGCTTCTAAAAAAGA
GTTGAGTAGTTTAAATGGGATTGGTTCTACAAAAGCTGAAGCTATTATTGTCTACAGAAAAGCCAACTGCTTTAAAAATG
TTAAAGAGCTTGCAAAGGTTAAAGGGATTGGTAAAAAAACAGTTGAGAAAAACATGAGTGATTTATCTGCTAGTCCTTGT
AAAAAATAA
ATGAAGTTTTTTGTGATTATTGCGCTAGGAGTTAGTTTATTGTTTGGTGCTGTTGATATTAACACTGCTTCTAAAAAAGA
GTTGAGTAGTTTAAATGGGATTGGTTCTACAAAAGCTGAAGCTATTATTGTCTACAGAAAAGCCAACTGCTTTAAAAATG
TTAAAGAGCTTGCAAAGGTTAAAGGGATTGGTAAAAAAACAGTTGAGAAAAACATGAGTGATTTATCTGCTAGTCCTTGT
AAAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| Cj0011c | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
54.795 |
89.024 |
0.488 |
| comE | Neisseria gonorrhoeae MS11 |
48.611 |
87.805 |
0.427 |
| comE | Neisseria gonorrhoeae MS11 |
48.611 |
87.805 |
0.427 |
| comE | Neisseria gonorrhoeae MS11 |
48.611 |
87.805 |
0.427 |
| comE | Neisseria gonorrhoeae MS11 |
48.611 |
87.805 |
0.427 |
| comEA | Legionella pneumophila strain ERS1305867 |
47.692 |
79.268 |
0.378 |
| comEA | Legionella pneumophila str. Paris |
47.692 |
79.268 |
0.378 |
| comEA | Acinetobacter baylyi ADP1 |
50 |
73.171 |
0.366 |
| comEA/comE1 | Glaesserella parasuis strain SC1401 |
53.571 |
68.293 |
0.366 |
| comE1/comEA | Haemophilus influenzae Rd KW20 |
53.571 |
68.293 |
0.366 |
| comEA | Vibrio cholerae C6706 |
53.571 |
68.293 |
0.366 |
| comEA | Vibrio cholerae strain A1552 |
53.571 |
68.293 |
0.366 |