Detailed information    

experimental Experimentally validated

Overview


Name   hns   Type   Regulator
Locus tag   H0N27_RS16170 Genome accession   NZ_CP059039
Coordinates   3462539..3462865 (-) Length   108 a.a.
NCBI ID   WP_000801427.1    Uniprot ID   A0A151YUA4
Organism   Acinetobacter baumannii strain A118     
Function   repress the expression of competence genes   
Competence regulation

Function


The expression levels of the natural transformation-related genes pilA, pilT, pilQ, comEA, comEC, comF, and drpA significantly increased in a Δhns derivative of A. baumannii A118.


Genomic Context


Location: 3457539..3467865
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0N27_RS16150 (H0N27_16105) - 3457654..3458283 (-) 630 WP_168727015.1 FHA domain-containing protein -
  H0N27_RS16155 (H0N27_16110) gspD 3458324..3460585 (-) 2262 WP_168727016.1 type II secretion system secretin GspD -
  H0N27_RS16160 (H0N27_16115) - 3460627..3461463 (-) 837 WP_000870031.1 type II secretion system protein N -
  H0N27_RS16165 (H0N27_16120) gspN 3461463..3462206 (-) 744 WP_000730343.1 type II secretion system protein N -
  H0N27_RS16170 (H0N27_16125) hns 3462539..3462865 (-) 327 WP_000801427.1 H-NS family nucleoid-associated regulatory protein Regulator
  H0N27_RS16175 (H0N27_16130) - 3463060..3463500 (-) 441 WP_000661569.1 acyl-CoA thioesterase -
  H0N27_RS16180 (H0N27_16135) - 3463508..3464701 (-) 1194 WP_000681775.1 membrane protein -
  H0N27_RS16185 (H0N27_16140) - 3464711..3465550 (-) 840 WP_001230194.1 hypothetical protein -
  H0N27_RS16190 (H0N27_16145) - 3465559..3466326 (-) 768 WP_000897410.1 uroporphyrinogen-III synthase -
  H0N27_RS16195 (H0N27_16150) hemC 3466331..3467248 (-) 918 WP_002159654.1 hydroxymethylbilane synthase -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  hns pilQ negative effect
  hns pilT negative effect
  hns comA/comEC negative effect
  hns comF negative effect
  hns pilA negative effect
  hns dprA negative effect
  hns comEA negative effect
  pilR pilA positive effect
  pilS pilR positive effect

Sequence


Protein


Download         Length: 108 a.a.        Molecular weight: 12462.12 Da        Isoelectric Point: 5.0524

>NTDB_id=1082 H0N27_RS16170 WP_000801427.1 3462539..3462865(-) (hns) [Acinetobacter baumannii strain A118]
MKPDISELSVEELKRLQEEAEALIASKKDQAIEDAYNQIIEIAENVGFSVEQLLEFGAQKRKKTTRKSVEPRYRNKNNAE
ETWTGRGKQPRWLVAEIEKGAKLEDFLI

Nucleotide


Download         Length: 327 bp        

>NTDB_id=1082 H0N27_RS16170 WP_000801427.1 3462539..3462865(-) (hns) [Acinetobacter baumannii strain A118]
ATGAAACCGGATATTAGTGAATTATCTGTTGAAGAGTTAAAACGCTTACAAGAAGAAGCAGAAGCTTTAATTGCAAGCAA
AAAAGATCAAGCAATCGAAGATGCTTATAATCAAATTATCGAAATTGCTGAAAATGTAGGTTTTAGTGTTGAACAGCTTC
TAGAATTTGGCGCTCAAAAACGTAAGAAAACAACACGTAAATCTGTAGAACCACGTTACCGTAACAAAAACAATGCTGAA
GAGACTTGGACTGGTCGCGGTAAACAACCACGTTGGTTAGTTGCTGAAATTGAAAAAGGTGCAAAACTTGAAGATTTCTT
AATCTAA

Domains


Predicted by InterProScan.

(12-102)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A151YUA4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Casin Le et al. (2021) Involvement of the Histone-Like Nucleoid Structuring Protein (H-NS) in Acinetobacter baumannii's Natural Transformation. Pathogens (Basel, Switzerland) 10(9):1083. [PMID: 34578115]