Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ACI3ES_RS09955 | Genome accession | NZ_CP174386 |
| Coordinates | 1954710..1955156 (-) | Length | 148 a.a. |
| NCBI ID | WP_317211836.1 | Uniprot ID | - |
| Organism | Leuconostoc falkenbergense strain SAEED 24451 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1924317..1962706 | 1954710..1955156 | within | 0 |
Gene organization within MGE regions
Location: 1924317..1962706
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACI3ES_RS09720 | - | 1924317..1925267 (-) | 951 | WP_317211817.1 | N-acetylmuramoyl-L-alanine amidase | - |
| ACI3ES_RS09725 | - | 1925279..1925701 (-) | 423 | WP_317211815.1 | hypothetical protein | - |
| ACI3ES_RS09730 | - | 1925754..1926020 (-) | 267 | WP_317211814.1 | hypothetical protein | - |
| ACI3ES_RS09735 | - | 1926022..1926258 (-) | 237 | WP_317211812.1 | hypothetical protein | - |
| ACI3ES_RS09740 | - | 1926261..1926659 (-) | 399 | WP_188353872.1 | hypothetical protein | - |
| ACI3ES_RS09745 | - | 1926656..1926958 (-) | 303 | WP_188353873.1 | hypothetical protein | - |
| ACI3ES_RS09750 | - | 1926970..1931874 (-) | 4905 | WP_407631984.1 | phage tail spike protein | - |
| ACI3ES_RS09755 | - | 1931871..1932677 (-) | 807 | WP_317211276.1 | distal tail protein Dit | - |
| ACI3ES_RS09760 | - | 1932696..1935671 (-) | 2976 | WP_317211275.1 | tape measure protein | - |
| ACI3ES_RS09765 | - | 1935752..1935955 (+) | 204 | WP_317211273.1 | hypothetical protein | - |
| ACI3ES_RS09770 | - | 1935952..1936092 (-) | 141 | WP_317211270.1 | hypothetical protein | - |
| ACI3ES_RS09775 | - | 1936104..1936259 (-) | 156 | WP_317211268.1 | hypothetical protein | - |
| ACI3ES_RS09780 | - | 1936268..1936576 (-) | 309 | WP_407631985.1 | hypothetical protein | - |
| ACI3ES_RS09785 | - | 1936690..1937028 (-) | 339 | WP_004912507.1 | tail assembly chaperone | - |
| ACI3ES_RS09790 | - | 1937099..1937689 (-) | 591 | WP_407631986.1 | phage major tail protein, TP901-1 family | - |
| ACI3ES_RS09795 | - | 1937703..1938098 (-) | 396 | WP_142511778.1 | DUF3168 domain-containing protein | - |
| ACI3ES_RS09800 | - | 1938095..1938454 (-) | 360 | WP_188353845.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACI3ES_RS09805 | - | 1938447..1938758 (-) | 312 | WP_142511776.1 | hypothetical protein | - |
| ACI3ES_RS09810 | - | 1938767..1939105 (-) | 339 | WP_114667753.1 | phage head-tail connector protein | - |
| ACI3ES_RS09815 | - | 1939169..1939429 (-) | 261 | WP_242029688.1 | Ig-like domain-containing protein | - |
| ACI3ES_RS09820 | - | 1939422..1940252 (-) | 831 | Protein_1904 | N4-gp56 family major capsid protein | - |
| ACI3ES_RS09825 | - | 1940257..1940841 (-) | 585 | WP_407631987.1 | DUF4355 domain-containing protein | - |
| ACI3ES_RS09830 | - | 1941010..1941954 (-) | 945 | WP_317212168.1 | minor capsid protein | - |
| ACI3ES_RS09835 | - | 1941929..1943437 (-) | 1509 | WP_407631988.1 | phage portal protein | - |
| ACI3ES_RS09840 | - | 1943437..1943658 (-) | 222 | WP_273709460.1 | hypothetical protein | - |
| ACI3ES_RS09845 | - | 1943665..1944957 (-) | 1293 | WP_317211861.1 | PBSX family phage terminase large subunit | - |
| ACI3ES_RS09850 | - | 1944957..1945445 (-) | 489 | WP_114667446.1 | terminase small subunit | - |
| ACI3ES_RS09855 | - | 1945516..1945788 (-) | 273 | WP_317211860.1 | hypothetical protein | - |
| ACI3ES_RS09860 | - | 1945838..1945966 (-) | 129 | WP_317211859.1 | hypothetical protein | - |
| ACI3ES_RS09865 | - | 1946025..1946204 (-) | 180 | WP_273706676.1 | hypothetical protein | - |
| ACI3ES_RS09870 | - | 1946201..1946407 (-) | 207 | WP_317211858.1 | hypothetical protein | - |
| ACI3ES_RS09875 | - | 1946438..1947670 (-) | 1233 | WP_317211857.1 | helix-turn-helix domain-containing protein | - |
| ACI3ES_RS09880 | - | 1947670..1947840 (-) | 171 | WP_181809930.1 | hypothetical protein | - |
| ACI3ES_RS09885 | - | 1948230..1948418 (-) | 189 | WP_317211855.1 | hypothetical protein | - |
| ACI3ES_RS09890 | - | 1948745..1949203 (-) | 459 | WP_243132419.1 | hypothetical protein | - |
| ACI3ES_RS09895 | - | 1949302..1949733 (+) | 432 | WP_317211852.1 | hypothetical protein | - |
| ACI3ES_RS09900 | - | 1949730..1950038 (+) | 309 | WP_317211851.1 | hypothetical protein | - |
| ACI3ES_RS09905 | - | 1950207..1950389 (-) | 183 | WP_289456428.1 | hypothetical protein | - |
| ACI3ES_RS09910 | - | 1950389..1950913 (-) | 525 | WP_317211849.1 | hypothetical protein | - |
| ACI3ES_RS09915 | - | 1950913..1951248 (-) | 336 | WP_317211848.1 | hypothetical protein | - |
| ACI3ES_RS09920 | - | 1951253..1951399 (-) | 147 | WP_317211846.1 | hypothetical protein | - |
| ACI3ES_RS09925 | - | 1951368..1951829 (-) | 462 | WP_317211845.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACI3ES_RS09930 | - | 1951826..1952239 (-) | 414 | WP_084013399.1 | hypothetical protein | - |
| ACI3ES_RS09935 | - | 1952348..1953052 (-) | 705 | WP_317211842.1 | putative HNHc nuclease | - |
| ACI3ES_RS09940 | - | 1953052..1953666 (-) | 615 | WP_317211840.1 | hypothetical protein | - |
| ACI3ES_RS09945 | - | 1953663..1953929 (-) | 267 | WP_317211839.1 | hypothetical protein | - |
| ACI3ES_RS09950 | - | 1953899..1954699 (-) | 801 | WP_317211837.1 | helix-turn-helix domain-containing protein | - |
| ACI3ES_RS09955 | ssb | 1954710..1955156 (-) | 447 | WP_317211836.1 | single-stranded DNA-binding protein | Machinery gene |
| ACI3ES_RS09960 | - | 1955156..1955812 (-) | 657 | WP_317211834.1 | ERF family protein | - |
| ACI3ES_RS09965 | - | 1955815..1956018 (-) | 204 | WP_317211833.1 | hypothetical protein | - |
| ACI3ES_RS09970 | - | 1956109..1956333 (-) | 225 | WP_317211831.1 | hypothetical protein | - |
| ACI3ES_RS09975 | - | 1956335..1956682 (-) | 348 | WP_317211830.1 | hypothetical protein | - |
| ACI3ES_RS09980 | - | 1956679..1956846 (-) | 168 | WP_317211828.1 | hypothetical protein | - |
| ACI3ES_RS09985 | - | 1956941..1957387 (+) | 447 | WP_114667467.1 | hypothetical protein | - |
| ACI3ES_RS09990 | - | 1957518..1958249 (-) | 732 | WP_407631989.1 | phage antirepressor KilAC domain-containing protein | - |
| ACI3ES_RS09995 | - | 1958255..1958458 (-) | 204 | WP_061399521.1 | hypothetical protein | - |
| ACI3ES_RS10000 | - | 1958461..1958922 (-) | 462 | WP_317211707.1 | phage N-6-adenine-methyltransferase | - |
| ACI3ES_RS10005 | - | 1958922..1959053 (-) | 132 | WP_267287227.1 | hypothetical protein | - |
| ACI3ES_RS10010 | - | 1959110..1959352 (-) | 243 | WP_317211703.1 | helix-turn-helix transcriptional regulator | - |
| ACI3ES_RS10015 | - | 1959505..1960191 (+) | 687 | WP_317211701.1 | XRE family transcriptional regulator | - |
| ACI3ES_RS10020 | - | 1960206..1960514 (+) | 309 | WP_147651106.1 | hypothetical protein | - |
| ACI3ES_RS10025 | - | 1960578..1961342 (+) | 765 | WP_317211698.1 | DUF5067 domain-containing protein | - |
| ACI3ES_RS10030 | - | 1961639..1962706 (+) | 1068 | WP_317211696.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16294.02 Da Isoelectric Point: 5.2707
>NTDB_id=1077029 ACI3ES_RS09955 WP_317211836.1 1954710..1955156(-) (ssb) [Leuconostoc falkenbergense strain SAEED 24451]
MINRVVLIGRLTKDVEVRYTQSGVAVGTFSLAVNRPFTNASGEREADFINGVIWRKSAENFANFTHKGALVAIEGRLQTR
NYEDGNGKRVYVTEVVADNFSLLEKKSDSQQSSPESQTPDPFSSKGKQNKFAGSGNTEVDISDDDLPF
MINRVVLIGRLTKDVEVRYTQSGVAVGTFSLAVNRPFTNASGEREADFINGVIWRKSAENFANFTHKGALVAIEGRLQTR
NYEDGNGKRVYVTEVVADNFSLLEKKSDSQQSSPESQTPDPFSSKGKQNKFAGSGNTEVDISDDDLPF
Nucleotide
Download Length: 447 bp
>NTDB_id=1077029 ACI3ES_RS09955 WP_317211836.1 1954710..1955156(-) (ssb) [Leuconostoc falkenbergense strain SAEED 24451]
ATGATTAACAGAGTAGTGCTTATTGGTCGATTGACCAAAGATGTTGAAGTTAGGTACACACAATCAGGTGTGGCGGTTGG
AACATTTAGTTTAGCCGTTAATCGTCCATTTACGAATGCTAGTGGCGAACGTGAAGCGGACTTTATCAATGGTGTTATCT
GGCGTAAATCAGCCGAAAACTTCGCTAACTTCACACACAAAGGTGCGCTAGTAGCGATTGAGGGGCGACTACAAACACGC
AACTACGAAGACGGAAACGGCAAACGTGTTTATGTCACAGAAGTTGTAGCTGATAATTTCAGTCTTTTGGAAAAGAAGAG
TGACAGTCAGCAATCATCACCAGAGTCACAAACACCTGATCCATTTTCAAGTAAAGGCAAACAAAATAAATTTGCTGGTA
GTGGCAATACTGAAGTTGACATTTCAGATGATGATTTGCCCTTCTAA
ATGATTAACAGAGTAGTGCTTATTGGTCGATTGACCAAAGATGTTGAAGTTAGGTACACACAATCAGGTGTGGCGGTTGG
AACATTTAGTTTAGCCGTTAATCGTCCATTTACGAATGCTAGTGGCGAACGTGAAGCGGACTTTATCAATGGTGTTATCT
GGCGTAAATCAGCCGAAAACTTCGCTAACTTCACACACAAAGGTGCGCTAGTAGCGATTGAGGGGCGACTACAAACACGC
AACTACGAAGACGGAAACGGCAAACGTGTTTATGTCACAGAAGTTGTAGCTGATAATTTCAGTCTTTTGGAAAAGAAGAG
TGACAGTCAGCAATCATCACCAGAGTCACAAACACCTGATCCATTTTCAAGTAAAGGCAAACAAAATAAATTTGCTGGTA
GTGGCAATACTGAAGTTGACATTTCAGATGATGATTTGCCCTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.895 |
100 |
0.669 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52 |
100 |
0.615 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.66 |
71.622 |
0.399 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.838 |
100 |
0.378 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.838 |
100 |
0.378 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.162 |
100 |
0.372 |