Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | ACIV1F_RS06180 | Genome accession | NZ_CP173176 |
| Coordinates | 1241445..1241756 (+) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain SA0413Rev | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1236445..1246756
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACIV1F_RS06150 (ACIV1F_001230) | - | 1237228..1237431 (+) | 204 | WP_000087561.1 | YqgQ family protein | - |
| ACIV1F_RS06155 (ACIV1F_001231) | - | 1237428..1238414 (+) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| ACIV1F_RS06160 (ACIV1F_001232) | - | 1238414..1238743 (+) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| ACIV1F_RS06165 (ACIV1F_001233) | - | 1238740..1239363 (+) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| ACIV1F_RS06170 (ACIV1F_001234) | comGA | 1239415..1240389 (+) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| ACIV1F_RS06175 (ACIV1F_001235) | comGB | 1240361..1241431 (+) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| ACIV1F_RS06180 (ACIV1F_001236) | comGC | 1241445..1241756 (+) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACIV1F_RS06185 (ACIV1F_001237) | comGD | 1241734..1242180 (+) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACIV1F_RS06190 (ACIV1F_001238) | comGE | 1242167..1242466 (+) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| ACIV1F_RS06195 (ACIV1F_001239) | comGF | 1242384..1242881 (+) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| ACIV1F_RS06200 (ACIV1F_001240) | - | 1242978..1243124 (+) | 147 | WP_001789879.1 | hypothetical protein | - |
| ACIV1F_RS06205 (ACIV1F_001241) | - | 1243114..1243638 (+) | 525 | WP_001015117.1 | shikimate kinase | - |
| ACIV1F_RS06210 (ACIV1F_001242) | gcvT | 1243797..1244888 (+) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACIV1F_RS06215 (ACIV1F_001243) | gcvPA | 1244908..1246254 (+) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=1070447 ACIV1F_RS06180 WP_000472256.1 1241445..1241756(+) (comGC) [Staphylococcus aureus strain SA0413Rev]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=1070447 ACIV1F_RS06180 WP_000472256.1 1241445..1241756(+) (comGC) [Staphylococcus aureus strain SA0413Rev]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |