Detailed information NTG1069061

Bioinformatically predicted

Overview

• Name: comYF
• Type: Machinery gene
• Locus tag: ACF1RT_RS01140
• Genome accession: NZ_CP172847
• Coordinates: 231939..232373 (+)
• Length: 144 a.a.
• NCBI ID: WP_002263440.1
• Uniprot ID: -
• Organism: Streptococcus mutans strain DPC6143
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 226939..237373

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACF1RT_RS01110 (ACF1RT_01110)	-	228561..228944 (+)	384	WP_002264248.1	DUF1033 family protein	-
ACF1RT_RS01115 (ACF1RT_01115)	comYA	229074..230015 (+)	942	WP_002263435.1	competence type IV pilus ATPase ComGA	Machinery gene
ACF1RT_RS01120 (ACF1RT_01120)	comYB	229951..230982 (+)	1032	WP_255262788.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACF1RT_RS01125 (ACF1RT_01125)	comYC	230982..231296 (+)	315	WP_002263437.1	competence type IV pilus major pilin ComGC	Machinery gene
ACF1RT_RS01130 (ACF1RT_01130)	comYD	231283..231687 (+)	405	WP_002263438.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACF1RT_RS01135 (ACF1RT_01135)	comYE	231659..231952 (+)	294	WP_002263439.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACF1RT_RS01140 (ACF1RT_01140)	comYF	231939..232373 (+)	435	WP_002263440.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACF1RT_RS01145 (ACF1RT_01145)	comYG	232351..232740 (+)	390	WP_226711279.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACF1RT_RS01150 (ACF1RT_01150)	comYH	232795..233748 (+)	954	WP_002269808.1	class I SAM-dependent methyltransferase	Machinery gene
ACF1RT_RS01155 (ACF1RT_01155)	-	233807..235006 (+)	1200	WP_002263443.1	acetate kinase	-
ACF1RT_RS01160 (ACF1RT_01160)	tnpA	235219..235682 (+)	464	Protein_203	IS200/IS605 family transposase	-
ACF1RT_RS01165 (ACF1RT_01165)	-	236310..236555 (+)	246	WP_002263444.1	helix-turn-helix transcriptional regulator	-
ACF1RT_RS01170 (ACF1RT_01170)	-	236524..236964 (+)	441	WP_002264006.1	hypothetical protein	-

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 16266.75 Da
• Isoelectric Point: 9.9512

>NTDB_id=1069061 ACF1RT_RS01140 WP_002263440.1 231939..232373(+) (comYF) [Streptococcus mutans strain DPC6143]
MLKSKLKAFTLLECLLALLVIAGSVSVYNGLTKAISSNIHYLSKNQEDAWLLFCQQFRSELEGTTLQKLDSNKLYIQKNN
QSLAFGKSKASDFRKTNSDGRGYQPMLTEIKAANFSQSGKIIKLDLTFKDGLERTFVYAFHEKN

Nucleotide

• Length: 435 bp

>NTDB_id=1069061 ACF1RT_RS01140 WP_002263440.1 231939..232373(+) (comYF) [Streptococcus mutans strain DPC6143]
TTGTTAAAAAGTAAATTGAAAGCTTTCACACTTTTAGAGTGTCTCCTTGCTTTGCTTGTCATTGCTGGTAGTGTATCTGT
TTATAATGGTCTAACTAAAGCTATTAGTAGTAATATTCATTACTTATCAAAAAATCAAGAAGATGCTTGGTTACTTTTTT
GTCAGCAATTTCGGTCTGAACTTGAAGGAACGACTTTGCAAAAATTGGATAGCAATAAGCTTTATATTCAAAAAAATAAT
CAAAGTTTAGCCTTTGGTAAATCAAAAGCAAGTGATTTTAGAAAGACTAACAGTGATGGACGTGGTTATCAGCCTATGTT
GACGGAGATCAAAGCTGCTAATTTTAGTCAATCAGGAAAAATTATTAAATTAGACCTTACTTTCAAAGATGGTTTAGAGA
GGACTTTTGTTTATGCTTTTCATGAAAAAAATTAA

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (36-133)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYF	Streptococcus mutans UA159	100	100	1
comYF	Streptococcus mutans UA140	99.306	100	0.993
comGF	Lactococcus lactis subsp. cremoris KW2	43.262	97.917	0.424
comGF/cglF	Streptococcus pneumoniae Rx1	40.299	93.056	0.375
comGF/cglF	Streptococcus pneumoniae D39	40.299	93.056	0.375
comGF/cglF	Streptococcus pneumoniae R6	40.299	93.056	0.375
comGF/cglF	Streptococcus pneumoniae TIGR4	40.299	93.056	0.375
comGF/cglF	Streptococcus mitis NCTC 12261	38.806	93.056	0.361