Detailed information
Bioinformatically predicted
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | ACF0HT_RS06680 | Genome accession | NZ_CP171612 |
| Coordinates | 1381722..1382039 (+) | Length | 105 a.a. |
| NCBI ID | WP_029377192.1 | Uniprot ID | - |
| Organism | Staphylococcus xylosus strain 14BME18 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1376722..1387039
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACF0HT_RS06650 (ACF0HT_06650) | - | 1377072..1377266 (+) | 195 | WP_042363548.1 | YqgQ family protein | - |
| ACF0HT_RS06655 (ACF0HT_06655) | - | 1377656..1378642 (+) | 987 | WP_029377187.1 | glucokinase | - |
| ACF0HT_RS06660 (ACF0HT_06660) | - | 1378642..1378965 (+) | 324 | WP_042362616.1 | MTH1187 family thiamine-binding protein | - |
| ACF0HT_RS06665 (ACF0HT_06665) | - | 1378967..1379590 (+) | 624 | WP_042362617.1 | MBL fold metallo-hydrolase | - |
| ACF0HT_RS06670 (ACF0HT_06670) | comGA | 1379689..1380663 (+) | 975 | WP_069794318.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| ACF0HT_RS06675 (ACF0HT_06675) | comGB | 1380635..1381702 (+) | 1068 | WP_069794319.1 | competence type IV pilus assembly protein ComGB | - |
| ACF0HT_RS06680 (ACF0HT_06680) | comGC | 1381722..1382039 (+) | 318 | WP_029377192.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACF0HT_RS06685 (ACF0HT_06685) | comGD | 1382020..1382463 (+) | 444 | WP_225523058.1 | competence type IV pilus minor pilin ComGD | - |
| ACF0HT_RS06690 (ACF0HT_06690) | - | 1382450..1382749 (+) | 300 | WP_069794320.1 | hypothetical protein | - |
| ACF0HT_RS06695 (ACF0HT_06695) | comGF | 1382721..1383164 (+) | 444 | WP_069794321.1 | competence type IV pilus minor pilin ComGF | - |
| ACF0HT_RS06700 (ACF0HT_06700) | - | 1383323..1383844 (+) | 522 | WP_394523293.1 | shikimate kinase | - |
| ACF0HT_RS06705 (ACF0HT_06705) | gcvT | 1384032..1385123 (+) | 1092 | WP_042362624.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACF0HT_RS06710 (ACF0HT_06710) | gcvPA | 1385141..1386493 (+) | 1353 | WP_042362625.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
Sequence
Protein
Download Length: 105 a.a. Molecular weight: 11788.86 Da Isoelectric Point: 8.4952
>NTDB_id=1062341 ACF0HT_RS06680 WP_029377192.1 1381722..1382039(+) (comGC) [Staphylococcus xylosus strain 14BME18]
MNNFKNKFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQTTSCEAQLKMVDSQIEAYSLKFNKKPTTMDELVNEG
YIKENQKQCKSGALISINDGEAVAN
MNNFKNKFNKKAFTLIEMLLVLLIISLLLILIIPNIAKQSSHIQTTSCEAQLKMVDSQIEAYSLKFNKKPTTMDELVNEG
YIKENQKQCKSGALISINDGEAVAN
Nucleotide
Download Length: 318 bp
>NTDB_id=1062341 ACF0HT_RS06680 WP_029377192.1 1381722..1382039(+) (comGC) [Staphylococcus xylosus strain 14BME18]
ATGAATAATTTTAAAAATAAGTTTAACAAAAAGGCATTTACACTCATTGAAATGCTATTGGTTTTACTAATAATAAGTTT
GTTATTAATACTAATAATACCTAATATAGCTAAACAATCCTCACACATACAAACAACTAGTTGTGAAGCGCAACTCAAAA
TGGTAGATAGTCAAATTGAAGCTTATAGCTTGAAGTTCAATAAGAAGCCAACTACTATGGATGAACTCGTCAACGAAGGT
TATATCAAAGAGAACCAAAAACAATGTAAGTCAGGTGCCTTAATATCTATAAATGATGGTGAAGCAGTTGCAAATTAA
ATGAATAATTTTAAAAATAAGTTTAACAAAAAGGCATTTACACTCATTGAAATGCTATTGGTTTTACTAATAATAAGTTT
GTTATTAATACTAATAATACCTAATATAGCTAAACAATCCTCACACATACAAACAACTAGTTGTGAAGCGCAACTCAAAA
TGGTAGATAGTCAAATTGAAGCTTATAGCTTGAAGTTCAATAAGAAGCCAACTACTATGGATGAACTCGTCAACGAAGGT
TATATCAAAGAGAACCAAAAACAATGTAAGTCAGGTGCCTTAATATCTATAAATGATGGTGAAGCAGTTGCAAATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
70.297 |
96.19 |
0.676 |
| comGC | Staphylococcus aureus MW2 |
70.297 |
96.19 |
0.676 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
46.296 |
100 |
0.476 |
| comGC/cglC | Streptococcus pneumoniae D39 |
39.623 |
100 |
0.4 |
| comGC/cglC | Streptococcus pneumoniae R6 |
39.623 |
100 |
0.4 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
39.623 |
100 |
0.4 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
39.623 |
100 |
0.4 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
40 |
100 |
0.4 |
| comGC/cglC | Streptococcus mitis SK321 |
41.667 |
91.429 |
0.381 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.489 |
89.524 |
0.371 |
| comYC | Streptococcus mutans UA140 |
49.351 |
73.333 |
0.362 |
| comYC | Streptococcus mutans UA159 |
49.351 |
73.333 |
0.362 |