Detailed information NTG1057019

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACFIOL_RS06185
• Genome accession: NZ_CP170416
• Coordinates: 1209307..1209618 (+)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain t21644
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1204307..1214618

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACFIOL_RS06155	-	1205090..1205293 (+)	204	WP_000087561.1	YqgQ family protein	-
ACFIOL_RS06160	-	1205290..1206276 (+)	987	WP_000161314.1	ROK family glucokinase	-
ACFIOL_RS06165	-	1206276..1206605 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
ACFIOL_RS06170	-	1206602..1207225 (+)	624	WP_001223010.1	MBL fold metallo-hydrolase	-
ACFIOL_RS06175	comGA	1207277..1208251 (+)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
ACFIOL_RS06180	comGB	1208223..1209293 (+)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACFIOL_RS06185	comGC	1209307..1209618 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
ACFIOL_RS06190	comGD	1209596..1210042 (+)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACFIOL_RS06195	comGE	1210029..1210328 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
ACFIOL_RS06200	comGF	1210246..1210743 (+)	498	WP_001789864.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACFIOL_RS06205	-	1210840..1210986 (+)	147	WP_001789879.1	hypothetical protein	-
ACFIOL_RS06210	-	1210976..1211500 (+)	525	WP_001015121.1	shikimate kinase	-
ACFIOL_RS06215	gcvT	1211659..1212750 (+)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
ACFIOL_RS06220	gcvPA	1212770..1214116 (+)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=1057019 ACFIOL_RS06185 WP_000472256.1 1209307..1209618(+) (comGC) [Staphylococcus aureus strain t21644]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=1057019 ACFIOL_RS06185 WP_000472256.1 1209307..1209618(+) (comGC) [Staphylococcus aureus strain t21644]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369