NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	ACLV7A_RS03185	Genome accession	NZ_OZ217344
Coordinates	624986..625456 (+)	Length	156 a.a.
NCBI ID	WP_000609606.1	Uniprot ID	A0A2I1UFP5
Organism	Streptococcus mitis isolate S. mitis E22
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 619986..630456

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACLV7A_RS03160 (SMIE22_06170)	-	621139..621627 (+)	489	WP_045607351.1	DUF5590 domain-containing protein	-
ACLV7A_RS03165 (SMIE22_06180)	-	621624..622811 (+)	1188	WP_411863572.1	pyridoxal phosphate-dependent aminotransferase	-
ACLV7A_RS03170 (SMIE22_06190)	-	622804..623169 (+)	366	WP_261063151.1	VOC family protein	-
ACLV7A_RS03175 (SMIE22_06200)	asnS	623188..624531 (+)	1344	WP_000167160.1	asparagine--tRNA ligase	-
ACLV7A_RS03180 (SMIE22_06210)	rpsF	624684..624974 (+)	291	WP_001151784.1	30S ribosomal protein S6	-
ACLV7A_RS03185 (SMIE22_06220)	ssbA	624986..625456 (+)	471	WP_000609606.1	single-stranded DNA-binding protein SsbA	Machinery gene
ACLV7A_RS03190 (SMIE22_06230)	rpsR	625488..625727 (+)	240	WP_000068664.1	30S ribosomal protein S18	-
ACLV7A_RS03195 (SMIE22_06240)	-	625768..627024 (-)	1257	WP_050213065.1	ISL3 family transposase	-
ACLV7A_RS03200 (SMIE22_06250)	-	627272..627775 (+)	504	WP_411863573.1	GNAT family N-acetyltransferase	-
ACLV7A_RS03205 (SMIE22_06260)	-	627858..629258 (+)	1401	WP_411863574.1	bifunctional Cof-type HAD-IIB family hydrolase/peptidylprolyl isomerase	-
ACLV7A_RS03210 (SMIE22_06270)	-	629260..629619 (+)	360	WP_173218116.1	S1 RNA-binding domain-containing protein	-
ACLV7A_RS03215 (SMIE22_06280)	-	629673..630422 (+)	750	WP_049525038.1	tRNA1(Val) (adenine(37)-N6)-methyltransferase	-

Sequence

Protein

Download Length: 156 a.a. Molecular weight: 17352.20 Da Isoelectric Point: 4.9164

                                >NTDB_id=1056103 ACLV7A_RS03185 WP_000609606.1 624986..625456(+) (ssbA) [Streptococcus mitis isolate S. mitis E22]

MINNVVLVGRMTRDAELRYTPSNVAVATFTLAVNRTFKSQNGEREADFINVVMWRQQAENLANWAKKGSLIGVTGRIQTR

SYDNQQGQRVYVTEVVAENFQMLESRSVREGHTGGAYSAPTANYSAPTNSVPDFSRDENPFGATNPLDISDDDLPF

Nucleotide

Download Length: 471 bp

                                >NTDB_id=1056103 ACLV7A_RS03185 WP_000609606.1 624986..625456(+) (ssbA) [Streptococcus mitis isolate S. mitis E22]

ATGATTAACAATGTTGTACTTGTAGGGCGTATGACACGTGACGCTGAGTTGCGTTATACCCCATCAAATGTAGCAGTTGC

GACTTTTACTCTTGCAGTAAACCGTACATTTAAGAGTCAAAATGGCGAACGTGAGGCTGATTTTATCAATGTCGTTATGT

GGCGCCAACAGGCTGAAAACCTTGCTAACTGGGCTAAAAAAGGCTCACTTATCGGGGTGACAGGCCGTATCCAGACTCGT

AGTTACGATAACCAGCAAGGACAACGTGTCTACGTGACAGAAGTCGTGGCTGAGAATTTCCAAATGTTGGAAAGCCGTAG

TGTGCGTGAAGGTCATACAGGTGGAGCTTACTCTGCCCCAACTGCAAACTATTCAGCACCTACAAATTCAGTGCCAGACT

TTTCACGTGATGAAAATCCATTTGGAGCAACAAATCCATTGGATATTTCAGATGATGATTTACCATTCTAA

Domains

Predicted by InterProScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A2I1UFP5

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	55.233	100	0.609
ssb	Latilactobacillus sakei subsp. sakei 23K	53.409	100	0.603
ssbB/cilA	Streptococcus pneumoniae TIGR4	51.282	75	0.385
ssbB	Bacillus subtilis subsp. subtilis str. 168	55.66	67.949	0.378
ssbB/cilA	Streptococcus pneumoniae R6	50.427	75	0.378
ssbB/cilA	Streptococcus mitis SK321	50.427	75	0.378
ssbB/cilA	Streptococcus mitis NCTC 12261	50.427	75	0.378
ssbB/cilA	Streptococcus pneumoniae Rx1	50.427	75	0.378
ssbB/cilA	Streptococcus pneumoniae D39	50.427	75	0.378
ssbB	Streptococcus sobrinus strain NIDR 6715-7	54.128	69.872	0.378

Detailed information NTG1056103