Detailed information NTG1019243

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB0R66_RS12980
• Genome accession: NZ_CP160214
• Coordinates: 2679679..2680116 (-)
• Length: 145 a.a.
• NCBI ID: WP_094032243.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain JJ747
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2674679..2685116

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB0R66_RS12930 (AB0R66_12930)	sinI	2675063..2675236 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
AB0R66_RS12935 (AB0R66_12935)	sinR	2675270..2675605 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
AB0R66_RS12940 (AB0R66_12940)	tasA	2675653..2676438 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
AB0R66_RS12945 (AB0R66_12945)	sipW	2676503..2677087 (-)	585	WP_015240205.1	signal peptidase I SipW	-
AB0R66_RS12950 (AB0R66_12950)	tapA	2677059..2677730 (-)	672	WP_015417813.1	amyloid fiber anchoring/assembly protein TapA	-
AB0R66_RS12955 (AB0R66_12955)	-	2677989..2678318 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
AB0R66_RS12960 (AB0R66_12960)	-	2678358..2678537 (-)	180	WP_003153093.1	YqzE family protein	-
AB0R66_RS12965 (AB0R66_12965)	comGG	2678594..2678971 (-)	378	WP_015417814.1	competence type IV pilus minor pilin ComGG	Machinery gene
AB0R66_RS12970 (AB0R66_12970)	comGF	2678972..2679472 (-)	501	WP_254922226.1	competence type IV pilus minor pilin ComGF	-
AB0R66_RS12975 (AB0R66_12975)	comGE	2679381..2679695 (-)	315	WP_094032244.1	competence type IV pilus minor pilin ComGE	-
AB0R66_RS12980 (AB0R66_12980)	comGD	2679679..2680116 (-)	438	WP_094032243.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB0R66_RS12985 (AB0R66_12985)	comGC	2680106..2680414 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
AB0R66_RS12990 (AB0R66_12990)	comGB	2680419..2681456 (-)	1038	WP_015417819.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB0R66_RS12995 (AB0R66_12995)	comGA	2681443..2682513 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
AB0R66_RS13000 (AB0R66_13000)	-	2682705..2683655 (-)	951	WP_015417820.1	magnesium transporter CorA family protein	-
AB0R66_RS13005 (AB0R66_13005)	-	2683801..2685102 (+)	1302	WP_241457553.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16254.72 Da
• Isoelectric Point: 10.2172

>NTDB_id=1019243 AB0R66_RS12980 WP_094032243.1 2679679..2680116(-) (comGD) [Bacillus velezensis strain JJ747]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPACTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHRYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1019243 AB0R66_RS12980 WP_094032243.1 2679679..2680116(-) (comGD) [Bacillus velezensis strain JJ747]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACAGTTTTGTTCACGACGGTTCCGCCGGCCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAGATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGTGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.164	100	0.566