Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | AB0R61_RS07990 | Genome accession | NZ_CP160003 |
| Coordinates | 1614734..1615045 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain Newman HOM | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1609734..1620045
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R61_RS07955 (AB0R61_07955) | gcvPA | 1610236..1611582 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| AB0R61_RS07960 (AB0R61_07960) | gcvT | 1611602..1612693 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R61_RS07965 (AB0R61_07965) | - | 1612852..1613376 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| AB0R61_RS07970 (AB0R61_07970) | - | 1613366..1613512 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| AB0R61_RS07975 (AB0R61_07975) | comGF | 1613609..1614106 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| AB0R61_RS07980 (AB0R61_07980) | comGE | 1614024..1614323 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| AB0R61_RS07985 (AB0R61_07985) | comGD | 1614310..1614756 (-) | 447 | WP_001790850.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| AB0R61_RS07990 (AB0R61_07990) | comGC | 1614734..1615045 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| AB0R61_RS07995 (AB0R61_07995) | comGB | 1615059..1616129 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| AB0R61_RS08000 (AB0R61_08000) | comGA | 1616101..1617075 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| AB0R61_RS08005 (AB0R61_08005) | - | 1617127..1617750 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| AB0R61_RS08010 (AB0R61_08010) | - | 1617747..1618076 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| AB0R61_RS08015 (AB0R61_08015) | - | 1618076..1619062 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| AB0R61_RS08020 (AB0R61_08020) | - | 1619059..1619262 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=1017061 AB0R61_RS07990 WP_000472256.1 1614734..1615045(-) (comGC) [Staphylococcus aureus strain Newman HOM]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=1017061 AB0R61_RS07990 WP_000472256.1 1614734..1615045(-) (comGC) [Staphylococcus aureus strain Newman HOM]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |