Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ABXJ25_RS13870 | Genome accession | NZ_CP159724 |
| Coordinates | 2778059..2778517 (-) | Length | 152 a.a. |
| NCBI ID | WP_002365911.1 | Uniprot ID | Q8VT46 |
| Organism | Enterococcus faecalis strain Z81-1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2722081..2785447 | 2778059..2778517 | within | 0 |
Gene organization within MGE regions
Location: 2722081..2785447
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABXJ25_RS13590 (ABXJ25_13610) | - | 2722252..2722583 (+) | 332 | Protein_2529 | PTS glucose transporter subunit IIA | - |
| ABXJ25_RS13595 (ABXJ25_13615) | - | 2722784..2723917 (-) | 1134 | WP_002377959.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| ABXJ25_RS13600 (ABXJ25_13620) | - | 2724020..2725090 (-) | 1071 | WP_010710139.1 | ammonium transporter | - |
| ABXJ25_RS13605 (ABXJ25_13625) | - | 2725284..2725687 (-) | 404 | Protein_2532 | NusG domain II-containing protein | - |
| ABXJ25_RS13610 (ABXJ25_13630) | - | 2725739..2726116 (-) | 378 | WP_002382844.1 | hypothetical protein | - |
| ABXJ25_RS13615 (ABXJ25_13635) | rpmF | 2726138..2726311 (-) | 174 | WP_002358539.1 | 50S ribosomal protein L32 | - |
| ABXJ25_RS13620 (ABXJ25_13640) | - | 2726650..2727705 (+) | 1056 | WP_002401430.1 | YibE/F family protein | - |
| ABXJ25_RS13625 (ABXJ25_13645) | - | 2727702..2728466 (+) | 765 | WP_002358536.1 | YibE/F family protein | - |
| ABXJ25_RS13630 (ABXJ25_13650) | - | 2729099..2729581 (-) | 483 | WP_002358535.1 | PTS glucose transporter subunit IIA | - |
| ABXJ25_RS13635 (ABXJ25_13655) | - | 2729592..2731094 (-) | 1503 | WP_002358534.1 | PTS transporter subunit EIIC | - |
| ABXJ25_RS13640 (ABXJ25_13660) | - | 2731087..2731794 (-) | 708 | WP_002358533.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| ABXJ25_RS13645 (ABXJ25_13665) | - | 2731950..2732768 (+) | 819 | WP_002358531.1 | MurR/RpiR family transcriptional regulator | - |
| ABXJ25_RS13650 (ABXJ25_13675) | - | 2733515..2734134 (-) | 620 | Protein_2541 | recombinase family protein | - |
| ABXJ25_RS13655 (ABXJ25_13680) | - | 2734318..2734938 (+) | 621 | WP_033591050.1 | recombinase family protein | - |
| ABXJ25_RS13660 (ABXJ25_13685) | - | 2734984..2735721 (-) | 738 | WP_002401428.1 | hypothetical protein | - |
| ABXJ25_RS13665 (ABXJ25_13690) | - | 2735709..2735810 (+) | 102 | Protein_2544 | IS30 family transposase | - |
| ABXJ25_RS13670 (ABXJ25_13695) | - | 2735946..2736362 (-) | 417 | WP_002358522.1 | hypothetical protein | - |
| ABXJ25_RS13675 (ABXJ25_13700) | - | 2736492..2737700 (-) | 1209 | WP_002358521.1 | YSIRK-targeted surface antigen transcriptional regulator | - |
| ABXJ25_RS13680 (ABXJ25_13705) | - | 2737900..2743521 (-) | 5622 | WP_354626948.1 | Rib/alpha-like domain-containing protein | - |
| ABXJ25_RS13685 (ABXJ25_13710) | - | 2743796..2744332 (-) | 537 | WP_002358518.1 | Asp23/Gls24 family envelope stress response protein | - |
| ABXJ25_RS13690 (ABXJ25_13715) | - | 2744361..2744552 (-) | 192 | WP_002358517.1 | DUF2273 domain-containing protein | - |
| ABXJ25_RS13695 (ABXJ25_13720) | amaP | 2744569..2745135 (-) | 567 | WP_010706722.1 | alkaline shock response membrane anchor protein AmaP | - |
| ABXJ25_RS13700 (ABXJ25_13725) | - | 2745405..2745692 (-) | 288 | WP_306418522.1 | S41 family peptidase | - |
| ABXJ25_RS13705 (ABXJ25_13730) | - | 2745706..2746287 (-) | 582 | WP_002401490.1 | hypothetical protein | - |
| ABXJ25_RS13710 (ABXJ25_13735) | - | 2746365..2746832 (-) | 468 | WP_002370921.1 | hypothetical protein | - |
| ABXJ25_RS13715 (ABXJ25_13740) | - | 2747269..2747832 (-) | 564 | WP_002370925.1 | hypothetical protein | - |
| ABXJ25_RS13720 (ABXJ25_13745) | - | 2748185..2749168 (-) | 984 | WP_002368282.1 | site-2 protease family protein | - |
| ABXJ25_RS13725 (ABXJ25_13750) | - | 2749169..2750407 (-) | 1239 | WP_002368283.1 | S8 family serine peptidase | - |
| ABXJ25_RS13730 (ABXJ25_13755) | - | 2750404..2752548 (-) | 2145 | WP_002370927.1 | peptidase domain-containing ABC transporter | - |
| ABXJ25_RS13735 (ABXJ25_13760) | - | 2752560..2755541 (-) | 2982 | WP_002370929.1 | type 2 lanthipeptide synthetase LanM family protein | - |
| ABXJ25_RS13740 (ABXJ25_13765) | cylL-S | 2755602..2755793 (-) | 192 | WP_002358181.1 | lanthipeptide cytolysin subunit CylL-S | - |
| ABXJ25_RS13745 (ABXJ25_13770) | cylL-L | 2755827..2756033 (-) | 207 | WP_002358485.1 | lanthipeptide cytolysin subunit CylL-L | - |
| ABXJ25_RS13750 (ABXJ25_13775) | cylR2 | 2756437..2756637 (+) | 201 | WP_002370931.1 | cytolysin regulator CylR2 | - |
| ABXJ25_RS13755 (ABXJ25_13780) | - | 2756975..2757289 (-) | 315 | WP_002403043.1 | hypothetical protein | - |
| ABXJ25_RS13760 (ABXJ25_13785) | - | 2757462..2758106 (-) | 645 | WP_002377952.1 | IS6 family transposase | - |
| ABXJ25_RS13765 (ABXJ25_13790) | - | 2758239..2759121 (+) | 883 | Protein_2564 | IS256 family transposase | - |
| ABXJ25_RS13770 (ABXJ25_13795) | - | 2759426..2760463 (-) | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| ABXJ25_RS13775 (ABXJ25_13800) | - | 2760489..2761427 (-) | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| ABXJ25_RS13780 (ABXJ25_13805) | - | 2761555..2761824 (-) | 270 | Protein_2567 | LPXTG cell wall anchor domain-containing protein | - |
| ABXJ25_RS13785 (ABXJ25_13810) | - | 2761914..2762099 (+) | 186 | WP_002358660.1 | hypothetical protein | - |
| ABXJ25_RS13790 (ABXJ25_13815) | - | 2762131..2762739 (+) | 609 | Protein_2569 | IS6 family transposase | - |
| ABXJ25_RS13795 (ABXJ25_13820) | bsh | 2763408..2764382 (-) | 975 | WP_002355428.1 | choloylglycine hydrolase | - |
| ABXJ25_RS13800 (ABXJ25_13825) | - | 2764606..2765250 (+) | 645 | WP_002377952.1 | IS6 family transposase | - |
| ABXJ25_RS13805 (ABXJ25_13830) | - | 2765441..2765716 (-) | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | - |
| ABXJ25_RS13810 (ABXJ25_13835) | - | 2765709..2765975 (-) | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| ABXJ25_RS13815 (ABXJ25_13840) | - | 2766086..2766670 (-) | 585 | WP_002377949.1 | thermonuclease family protein | - |
| ABXJ25_RS13820 (ABXJ25_13845) | - | 2766694..2767110 (-) | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| ABXJ25_RS13825 (ABXJ25_13850) | - | 2767186..2767434 (-) | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| ABXJ25_RS13830 (ABXJ25_13855) | - | 2767447..2767947 (-) | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| ABXJ25_RS13835 (ABXJ25_13860) | - | 2767980..2768264 (-) | 285 | WP_025189082.1 | hypothetical protein | - |
| ABXJ25_RS13840 (ABXJ25_13865) | - | 2768837..2769325 (-) | 489 | WP_010710133.1 | hypothetical protein | - |
| ABXJ25_RS13845 (ABXJ25_13870) | - | 2769331..2770116 (-) | 786 | WP_002360778.1 | replication-relaxation family protein | - |
| ABXJ25_RS13850 (ABXJ25_13875) | - | 2770504..2772762 (-) | 2259 | WP_010710132.1 | TraM recognition domain-containing protein | - |
| ABXJ25_RS13855 (ABXJ25_13880) | - | 2772749..2775094 (-) | 2346 | WP_002377940.1 | CD3337/EF1877 family mobilome membrane protein | - |
| ABXJ25_RS13860 (ABXJ25_13885) | - | 2775107..2775505 (-) | 399 | WP_002370287.1 | DUF4923 family protein | - |
| ABXJ25_RS13865 (ABXJ25_13890) | - | 2775462..2777954 (-) | 2493 | WP_002377939.1 | ATP-binding protein | - |
| ABXJ25_RS13870 (ABXJ25_13895) | ssb | 2778059..2778517 (-) | 459 | WP_002365911.1 | single-stranded DNA-binding protein | Machinery gene |
| ABXJ25_RS13875 (ABXJ25_13900) | - | 2778610..2779092 (-) | 483 | WP_002360790.1 | hypothetical protein | - |
| ABXJ25_RS13880 (ABXJ25_13905) | - | 2779124..2779513 (-) | 390 | WP_002360791.1 | TcpE family conjugal transfer membrane protein | - |
| ABXJ25_RS13885 (ABXJ25_13910) | - | 2779513..2779773 (-) | 261 | WP_010706916.1 | hypothetical protein | - |
| ABXJ25_RS13890 (ABXJ25_13915) | - | 2779778..2780812 (-) | 1035 | WP_002387763.1 | conjugal transfer protein | - |
| ABXJ25_RS13895 (ABXJ25_13920) | - | 2780805..2781119 (-) | 315 | WP_002360796.1 | hypothetical protein | - |
| ABXJ25_RS13900 (ABXJ25_13925) | - | 2781119..2781535 (-) | 417 | WP_354626961.1 | thioredoxin domain-containing protein | - |
| ABXJ25_RS13905 (ABXJ25_13930) | - | 2781519..2782136 (-) | 618 | WP_002409352.1 | hypothetical protein | - |
| ABXJ25_RS13910 (ABXJ25_13935) | - | 2782139..2783410 (-) | 1272 | WP_010711028.1 | CHAP domain-containing protein | - |
| ABXJ25_RS13915 (ABXJ25_13940) | - | 2783436..2784296 (-) | 861 | WP_010711027.1 | LPXTG cell wall anchor domain-containing protein | - |
| ABXJ25_RS13920 (ABXJ25_13945) | - | 2784316..2785194 (-) | 879 | WP_002365963.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 152 a.a. Molecular weight: 17179.08 Da Isoelectric Point: 4.6511
>NTDB_id=1015570 ABXJ25_RS13870 WP_002365911.1 2778059..2778517(-) (ssb) [Enterococcus faecalis strain Z81-1]
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
MINNVTLVGRLTKDPDLRYTQSGTAVGQFTLAINRNFTNANNEREADFINCVIWRKAAESLANYATKGTLIGLTGRIQTR
NYENQQGQRIYVTEVVTESFQLLESREVNEQRKEQATGKATFDKQSMDKPDPLDPFSPENSIVDISDNDLPF
Nucleotide
Download Length: 459 bp
>NTDB_id=1015570 ABXJ25_RS13870 WP_002365911.1 2778059..2778517(-) (ssb) [Enterococcus faecalis strain Z81-1]
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
TTGATTAATAACGTTACATTAGTTGGACGATTAACCAAAGACCCAGATTTAAGGTATACGCAAAGTGGAACAGCCGTAGG
TCAATTTACGTTGGCCATTAATCGCAACTTTACCAATGCTAACAATGAAAGGGAAGCAGATTTTATCAACTGTGTTATTT
GGCGGAAAGCTGCAGAGTCATTAGCAAATTATGCAACAAAAGGGACTCTGATCGGTTTAACTGGTCGCATTCAAACAAGA
AACTATGAGAATCAACAAGGCCAGCGTATTTATGTAACTGAGGTTGTCACAGAAAGCTTCCAACTATTAGAATCAAGAGA
AGTAAACGAGCAACGAAAAGAACAGGCTACAGGTAAAGCTACGTTTGATAAACAGTCAATGGATAAACCTGATCCTCTGG
ATCCATTTTCGCCAGAAAATAGCATAGTGGATATTTCTGATAATGACCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.471 |
100 |
0.632 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.283 |
100 |
0.572 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
69.737 |
0.395 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50 |
76.316 |
0.382 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
53.774 |
69.737 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
49.138 |
76.316 |
0.375 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
48.276 |
76.316 |
0.368 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.276 |
76.316 |
0.368 |