Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | UXR36_RS07720 | Genome accession | NZ_CP157773 |
| Coordinates | 1595996..1596307 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472255.1 | Uniprot ID | A0A0U1MLR1 |
| Organism | Staphylococcus aureus strain BSN89 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1590996..1601307
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR36_RS07685 (UXR36_007685) | gcvPA | 1591498..1592844 (-) | 1347 | WP_000019698.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| UXR36_RS07690 (UXR36_007690) | gcvT | 1592864..1593955 (-) | 1092 | WP_336389734.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| UXR36_RS07695 (UXR36_007695) | - | 1594114..1594638 (-) | 525 | WP_033858309.1 | shikimate kinase | - |
| UXR36_RS07700 (UXR36_007700) | - | 1594628..1594774 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| UXR36_RS07705 (UXR36_007705) | comGF | 1594871..1595368 (-) | 498 | WP_001796472.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| UXR36_RS07710 (UXR36_007710) | comGE | 1595286..1595585 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| UXR36_RS07715 (UXR36_007715) | comGD | 1595572..1596018 (-) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| UXR36_RS07720 (UXR36_007720) | comGC | 1595996..1596307 (-) | 312 | WP_000472255.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| UXR36_RS07725 (UXR36_007725) | comGB | 1596321..1597391 (-) | 1071 | WP_000776409.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| UXR36_RS07730 (UXR36_007730) | comGA | 1597363..1598337 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| UXR36_RS07735 (UXR36_007735) | - | 1598389..1599012 (-) | 624 | WP_001223009.1 | MBL fold metallo-hydrolase | - |
| UXR36_RS07740 (UXR36_007740) | - | 1599009..1599338 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| UXR36_RS07745 (UXR36_007745) | - | 1599338..1600324 (-) | 987 | WP_000161307.1 | ROK family glucokinase | - |
| UXR36_RS07750 (UXR36_007750) | - | 1600321..1600524 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11301.33 Da Isoelectric Point: 8.5268
>NTDB_id=1008264 UXR36_RS07720 WP_000472255.1 1595996..1596307(-) (comGC) [Staphylococcus aureus strain BSN89]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGESITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGESITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=1008264 UXR36_RS07720 WP_000472255.1 1595996..1596307(-) (comGC) [Staphylococcus aureus strain BSN89]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGTCAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGTCAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
99.029 |
100 |
0.99 |
| comGC | Staphylococcus aureus MW2 |
99.029 |
100 |
0.99 |
| comGC/cglC | Streptococcus mitis SK321 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |