Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | UXR35_RS08105 | Genome accession | NZ_CP157310 |
| Coordinates | 1664638..1664949 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BSN80 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1659638..1669949
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR35_RS08070 (UXR35_008070) | gcvPA | 1660140..1661486 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| UXR35_RS08075 (UXR35_008075) | gcvT | 1661506..1662597 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| UXR35_RS08080 (UXR35_008080) | - | 1662756..1663280 (-) | 525 | WP_001015117.1 | shikimate kinase | - |
| UXR35_RS08085 (UXR35_008085) | - | 1663270..1663416 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| UXR35_RS08090 (UXR35_008090) | comGF | 1663513..1664010 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| UXR35_RS08095 (UXR35_008095) | comGE | 1663928..1664227 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| UXR35_RS08100 (UXR35_008100) | comGD | 1664214..1664660 (-) | 447 | WP_001791635.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| UXR35_RS08105 (UXR35_008105) | comGC | 1664638..1664949 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| UXR35_RS08110 (UXR35_008110) | comGB | 1664963..1666033 (-) | 1071 | WP_000775708.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| UXR35_RS08115 (UXR35_008115) | comGA | 1666005..1666979 (-) | 975 | WP_000697228.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| UXR35_RS08120 (UXR35_008120) | - | 1667031..1667654 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| UXR35_RS08125 (UXR35_008125) | - | 1667651..1667980 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| UXR35_RS08130 (UXR35_008130) | - | 1667980..1668966 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| UXR35_RS08135 (UXR35_008135) | - | 1668963..1669166 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=1005814 UXR35_RS08105 WP_000472256.1 1664638..1664949(-) (comGC) [Staphylococcus aureus strain BSN80]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=1005814 UXR35_RS08105 WP_000472256.1 1664638..1664949(-) (comGC) [Staphylococcus aureus strain BSN80]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |