Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | UXR76_RS07845 | Genome accession | NZ_CP157306 |
| Coordinates | 1621870..1622181 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BSN85 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1616870..1627181
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| UXR76_RS07810 (UXR76_007810) | gcvPA | 1617372..1618718 (-) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| UXR76_RS07815 (UXR76_007815) | gcvT | 1618738..1619829 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| UXR76_RS07820 (UXR76_007820) | - | 1619988..1620512 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| UXR76_RS07825 (UXR76_007825) | - | 1620502..1620648 (-) | 147 | WP_001792109.1 | hypothetical protein | - |
| UXR76_RS07830 (UXR76_007830) | comGF | 1620745..1621242 (-) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| UXR76_RS07835 (UXR76_007835) | comGE | 1621160..1621459 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| UXR76_RS07840 (UXR76_007840) | comGD | 1621446..1621892 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| UXR76_RS07845 (UXR76_007845) | comGC | 1621870..1622181 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| UXR76_RS07850 (UXR76_007850) | comGB | 1622195..1623265 (-) | 1071 | WP_064265422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| UXR76_RS07855 (UXR76_007855) | comGA | 1623237..1624211 (-) | 975 | WP_000697221.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| UXR76_RS07860 (UXR76_007860) | - | 1624263..1624886 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| UXR76_RS07865 (UXR76_007865) | - | 1624883..1625212 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| UXR76_RS07870 (UXR76_007870) | - | 1625212..1626198 (-) | 987 | WP_000161311.1 | ROK family glucokinase | - |
| UXR76_RS07875 (UXR76_007875) | - | 1626195..1626398 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=1005725 UXR76_RS07845 WP_000472256.1 1621870..1622181(-) (comGC) [Staphylococcus aureus strain BSN85]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=1005725 UXR76_RS07845 WP_000472256.1 1621870..1622181(-) (comGC) [Staphylococcus aureus strain BSN85]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |