Detailed information NTG1005592

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: UXR77_RS08070
• Genome accession: NZ_CP157302
• Coordinates: 1642123..1642434 (-)
• Length: 103 a.a.
• NCBI ID: WP_073392422.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain BSN71
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1637123..1647434

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
UXR77_RS08035 (UXR77_008035)	gcvPA	1637625..1638971 (-)	1347	WP_103146438.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
UXR77_RS08040 (UXR77_008040)	gcvT	1638991..1640082 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
UXR77_RS08045 (UXR77_008045)	-	1640241..1640765 (-)	525	WP_001015117.1	shikimate kinase	-
UXR77_RS08050 (UXR77_008050)	-	1640755..1640901 (-)	147	WP_001789879.1	hypothetical protein	-
UXR77_RS08055 (UXR77_008055)	comGF	1640998..1641495 (-)	498	WP_001789864.1	competence type IV pilus minor pilin ComGF	Machinery gene
UXR77_RS08060 (UXR77_008060)	comGE	1641413..1641712 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
UXR77_RS08065 (UXR77_008065)	comGD	1641699..1642145 (-)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
UXR77_RS08070 (UXR77_008070)	comGC	1642123..1642434 (-)	312	WP_073392422.1	competence type IV pilus major pilin ComGC	Machinery gene
UXR77_RS08075 (UXR77_008075)	comGB	1642448..1643518 (-)	1071	WP_000775708.1	competence type IV pilus assembly protein ComGB	Machinery gene
UXR77_RS08080 (UXR77_008080)	comGA	1643490..1644464 (-)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
UXR77_RS08085 (UXR77_008085)	-	1644516..1645139 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
UXR77_RS08090 (UXR77_008090)	-	1645136..1645465 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
UXR77_RS08095 (UXR77_008095)	-	1645465..1646451 (-)	987	WP_000161314.1	ROK family glucokinase	-
UXR77_RS08100 (UXR77_008100)	-	1646448..1646651 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11329.38 Da
• Isoelectric Point: 8.5268

>NTDB_id=1005592 UXR77_RS08070 WP_073392422.1 1642123..1642434(-) (comGC) [Staphylococcus aureus strain BSN71]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEELIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=1005592 UXR77_RS08070 WP_073392422.1 1642123..1642434(-) (comGC) [Staphylococcus aureus strain BSN71]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGAATTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	79.612	0.379
comYC	Streptococcus suis isolate S10	48.718	75.728	0.369