Detailed information of regulator


Summary

Regulator ID REG0371 experimental
Regulator type protein
Regulatory pathway (from literatures) Unknown
KEGG pathway (determined by BlastKOALA) -
Related T6SS T6SS17506 experimental (Type i1)
Strain Aliivibrio fischeri strain ES401
Replicon chromosome
Sequence Protein sequence (150 a.a.); Nucleotide sequence (450 bp)
Description T6SS expression requires conserved structural proteins, in addition to the essential regulator TasR.
Reference

External database links

Locus tag (Gene) VFES401_RS15770 (tasR)
Coordinates (Strand) 373862..374311 (+)
NCBI ID WP_012535053.1
RefSeq NZ_SRJG01000005
Uniprot ID A0A1B9P6J0_ALIFS, B5EUJ9_ALIFM
KEGG ID vfm:VFMJ11_A0818
KEGG pathway (determined by BlastKOALA) -
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
hcp promotor -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
HTH_AsnC-type PF13404.8 1.2e-13 9..50
AsnC_trans_reg PF01037.23 6e-09 76..144

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-149 MSNMNLQGLDKLDRRIISNLLSNGRESIANLSRNVGLSRTAVAERINRLEKTGIIKGYTAQIRMGNKDENASSYLLISCNKGQKDSVSDGLKEIPEVKMTSIVGGTYDIICLIEAPDLHRIHYLCSEIESLSGIKEVKNTIVLHQPVCR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9544 - -



  Protein sequence of regulator: 150 a.a.    .

>REG0371 NZ_SRJG01000005:373862-374311 [Aliivibrio fischeri]
MSNMNLQGLDKLDRRIISNLLSNGRESIANLSRNVGLSRTAVAERINRLEKTGIIKGYTAQIRMGNKDENASSYLLISCN
KGQKDSVSDGLKEIPEVKMTSIVGGTYDIICLIEAPDLHRIHYLCSEIESLSGIKEVKNTIVLHQPVCR*

  Nucleotide sequence of regulator: 450 bp    .

>REG0371 NZ_SRJG01000005:373862-374311 [Aliivibrio fischeri]
ATGTCAAACATGAATCTACAAGGCTTGGATAAATTAGATAGAAGAATTATCTCTAATCTATTATCAAACGGTAGAGAGTC
TATTGCGAATCTTTCGCGTAACGTAGGTTTATCACGAACAGCGGTTGCTGAACGTATAAACCGACTTGAGAAAACGGGGA
TCATTAAAGGATATACAGCGCAAATCCGCATGGGAAATAAAGATGAAAATGCATCATCTTATTTACTTATCTCATGTAAT
AAAGGACAAAAAGACAGTGTTTCTGATGGATTAAAAGAAATTCCAGAAGTGAAAATGACGAGTATTGTTGGAGGAACTTA
CGATATTATCTGTTTAATTGAAGCGCCCGATTTACACCGAATTCATTACTTATGTAGCGAAATCGAATCGTTATCGGGCA
TAAAAGAAGTGAAAAATACCATCGTGTTGCACCAGCCAGTGTGTCGATAA