Detailed information of regulator


Summary

Regulator ID REG0357 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-HK
KEGG pathway (determined by BlastKOALA) Two-component system (map02020)
Related T6SS T6SS01034 experimental (Type i1)
Strain Escherichia coli PCN033
Replicon chromosome
Sequence Protein sequence (468 a.a.); Nucleotide sequence (1404 bp)
Description EMSA assays indicated that phosphorylated BaeR (BaeR-P) directly bound to promoter DNA region 1 of PCN033. A 294 bp fragment in the T6SS gene cluster was used for DNase I foot-printing assay. BaeR induced the expression of T6SS under zinc attack, which in turn directly contributed to bacteria zinc tolerance.
Reference

External database links

Locus tag (Gene) PPECC33_RS11180 (BaeS)
Coordinates (Strand) 2271464..2272867 (+)
NCBI ID 446597798
RefSeq NZ_CP006632
Uniprot ID A0A0E0XXE2_ECO1C, D3GZE2_ECO44, A0A0H3PL04_ECO5C, D6I9E6_ECOLX, C3SCS4_ECOLX, B7L9V1_ECO55, A0A237FS00_SHIBO, A0A0H2VVS0_SHIFL, A0A236BAI6_SHISO, A0A1X3I6W4_ECOLX, A0A0K9T9S7_ECOLX, A0A1X3LZ70_ECOLX, Q8X7I2_ECO57
KEGG ID ecs:ECs2886, elo:EC042_2317, sfl:SF2143, eck:EC55989_2334, esl:O3K_09040
KEGG pathway (determined by BlastKOALA) map02020
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
PPECC33_RS11185 (BaeR) 446060022

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
HATPase_c PF02518.28 1.7e-21 349..460
HAMP PF00672.27 9e-15 184..235
HisKA PF00512.27 4.5e-13 240..304

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-12 MKFWRPGITGKL
Transmembrane helix 13-35 FLAIFATCIVLLISMHWAVRISF
Inside 36-167 ERGFIDYIKHGNEQRLQLLSDALGEQYAQHGNWRFLRNNDRFVFQILRSFEHDNSEDKPGPGMPPHGWRTQFWVVDQNNKVLVGPRAPIPPDGTRRPILVNGAEVGAVIASPVERLTRNTDINFDKQQRQTS
Transmembrane helix 168-190 WLIVALATLLAALATFLLARGLL
Outside 191-467 APVKRLVDGTHKLAAGDFTTRVTPTSEDELGKLAQDFNQLASTLEKNQQMRRDFMADISHELRTPLAVLRGELEAIQDGVRKFTPETVASLQAEVGTLTKLVDDLHQLSMSDEGALAYQKAPVDLIPLLEVAGGAFRERFASRGLKLQFSLPDSITVFGDRDRLMQLFNNLLENSLRYTDSGGSLKISAEQHDKTVRLTFADSAPGVSDDQLQKLFERFYRTEGSRNRASGGSGLGLAICLNIVEAHNGRIIAAHSPFGGVSITVELPLERDLQREV



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9526 - -



  Protein sequence of regulator: 468 a.a.    .

>REG0357 NZ_CP006632:2271464-2272867 [Escherichia coli PCN033]
MKFWRPGITGKLFLAIFATCIVLLISMHWAVRISFERGFIDYIKHGNEQRLQLLSDALGEQYAQHGNWRFLRNNDRFVFQ
ILRSFEHDNSEDKPGPGMPPHGWRTQFWVVDQNNKVLVGPRAPIPPDGTRRPILVNGAEVGAVIASPVERLTRNTDINFD
KQQRQTSWLIVALATLLAALATFLLARGLLAPVKRLVDGTHKLAAGDFTTRVTPTSEDELGKLAQDFNQLASTLEKNQQM
RRDFMADISHELRTPLAVLRGELEAIQDGVRKFTPETVASLQAEVGTLTKLVDDLHQLSMSDEGALAYQKAPVDLIPLLE
VAGGAFRERFASRGLKLQFSLPDSITVFGDRDRLMQLFNNLLENSLRYTDSGGSLKISAEQHDKTVRLTFADSAPGVSDD
QLQKLFERFYRTEGSRNRASGGSGLGLAICLNIVEAHNGRIIAAHSPFGGVSITVELPLERDLQREV*

  Nucleotide sequence of regulator: 1404 bp    .

>REG0357 NZ_CP006632:2271464-2272867 [Escherichia coli PCN033]
ATGAAGTTCTGGCGACCCGGTATTACCGGCAAACTGTTTCTGGCGATTTTCGCCACCTGCATTGTCTTGCTGATCAGTAT
GCACTGGGCGGTGCGTATCAGTTTTGAGCGTGGCTTTATTGATTACATCAAGCATGGTAATGAACAGCGATTACAACTGT
TAAGTGATGCGCTTGGCGAGCAGTATGCGCAGCATGGTAACTGGCGCTTCCTGCGCAACAATGATCGCTTTGTCTTTCAG
ATCCTGCGTTCATTTGAACACGATAATTCGGAAGATAAACCCGGCCCGGGTATGCCACCGCACGGCTGGCGTACCCAGTT
CTGGGTGGTTGATCAAAACAACAAAGTGCTGGTTGGTCCGCGAGCGCCGATTCCACCTGACGGTACACGGCGACCCATTC
TGGTCAACGGTGCGGAAGTGGGTGCGGTGATTGCCTCCCCTGTTGAGCGACTGACCCGCAATACTGATATCAATTTCGAT
AAACAACAGCGGCAAACCAGCTGGCTGATTGTCGCTCTGGCAACGTTACTCGCGGCACTCGCTACCTTTCTGCTGGCGCG
TGGTTTGCTGGCACCGGTAAAACGGCTGGTGGACGGCACGCACAAACTGGCGGCGGGCGATTTCACTACCCGCGTGACGC
CCACCAGTGAAGATGAACTGGGCAAACTGGCGCAAGACTTCAACCAGCTCGCCAGCACGCTGGAGAAAAACCAGCAAATG
CGCCGCGATTTTATGGCCGATATTTCTCACGAACTGCGTACGCCATTAGCGGTGCTGCGCGGTGAACTGGAAGCCATTCA
GGATGGCGTGCGTAAATTCACGCCGGAGACGGTGGCGTCTTTACAGGCGGAGGTCGGTACACTGACCAAACTGGTTGACG
ATCTGCATCAGTTGTCGATGTCTGATGAAGGCGCTCTCGCCTATCAAAAAGCACCGGTAGATTTGATCCCACTGCTGGAA
GTGGCGGGCGGCGCATTTCGCGAACGATTCGCCAGCCGTGGCCTGAAACTGCAATTTTCCCTGCCAGACAGTATTACTGT
ATTTGGCGATCGCGACCGTTTAATGCAGTTATTCAATAACTTACTGGAAAACAGCCTGCGCTACACTGACAGCGGCGGCA
GCCTGAAAATCTCTGCCGAGCAGCACGACAAAACGGTGCGCCTGACCTTTGCTGACAGCGCGCCGGGCGTCAGTGACGAT
CAGCTACAAAAATTGTTTGAACGTTTTTATCGCACCGAAGGTTCCCGGAACCGCGCCAGCGGCGGTTCCGGGCTGGGGCT
GGCGATTTGCCTGAACATTGTTGAAGCACATAATGGCCGCATTATTGCTGCCCATTCGCCTTTTGGCGGGGTAAGCATTA
CAGTAGAGTTACCGCTGGAACGGGATTTACAGAGAGAAGTATGA