Detailed information of regulator


Summary

Regulator ID REG0339 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-HK
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Cationic antimicrobial peptide (CAMP) resistance (map01503)
Related T6SS T6SS01214 experimental (Type Unknown)
Strain Klebsiella pneumoniae strain Kp52.145
Replicon chromosome
Sequence Protein sequence (224 a.a.); Nucleotide sequence (672 bp)
Description Antimicrobial peptides activate the PhoPQ two-component system which, in turn, positively regulates Kp52145 T6SS resulting in increased T6SS-dependent antimicrobial activity.
Reference

External database links

Locus tag (Gene) BN49_RS12735 (phoP)
Coordinates (Strand) 2325637..2326308 (-)
NCBI ID 490252783
RefSeq NZ_FO834906
Uniprot ID A0A0H3GRL4_KLEPH, A0A1F2MF15_9ENTR, A0A223UD73_9ENTR, A0A087FMV9_KLEVA, A6T7J8_KLEP7, B5XSN8_KLEP3, A0A1Y0PZG2_KLEPN, R4YCR9_KLEPR
KEGG ID kpk:A593_20140, kpv:KPNIH29_10080, kvd:KR75_17815, kpn:KPN_01136, kpw:KPNIH30_10555, kpr:KPR_2181, kvq:SP68_24225, kpe:KPK_3415, kpg:KPNIH32_10395, kpy:KPNIH31_09985, kpm:KPHS_20130
KEGG pathway (determined by BlastKOALA) map02020; map01503
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
BN49_2224 (phoQ) 490249900

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 1e-24 3..112
Trans_reg_C PF00486.30 8.4e-20 145..220

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-223 MRVLVVEDNALLRHHLKVQLQELGHQVDAAEDAREADYYLGEHLPDIAIVDLGLPDEDGLSLIRRWRSHDVSLPVLVLTAREGWQDKVEVLSAGADDYVTKPFHIEEVAARMQALLRRNSGLASQVISLPPFQVDLSRRELSVNDQPIKLTAFEYTIMETLIRNRGKVVSKDSLMLQLYPDAELRESHTIDVLMGRLRKKIQAEYPQDVITTVRGQGYLFELR



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9970 - -



  Protein sequence of regulator: 224 a.a.    .

>REG0339 NZ_FO834906:c2326308-2325637 [Klebsiella pneumoniae]
MRVLVVEDNALLRHHLKVQLQELGHQVDAAEDAREADYYLGEHLPDIAIVDLGLPDEDGLSLIRRWRSHDVSLPVLVLTA
REGWQDKVEVLSAGADDYVTKPFHIEEVAARMQALLRRNSGLASQVISLPPFQVDLSRRELSVNDQPIKLTAFEYTIMET
LIRNRGKVVSKDSLMLQLYPDAELRESHTIDVLMGRLRKKIQAEYPQDVITTVRGQGYLFELR*

  Nucleotide sequence of regulator: 672 bp    .

>REG0339 NZ_FO834906:c2326308-2325637 [Klebsiella pneumoniae]
ATGCGCGTACTCGTGGTTGAGGATAATGCCCTGCTGCGTCACCACCTCAAAGTTCAGCTGCAGGAGCTGGGCCATCAGGT
CGATGCGGCGGAAGATGCCAGGGAAGCGGACTACTATCTGGGCGAACATCTCCCGGATATCGCCATCGTCGATCTCGGCC
TGCCGGATGAAGACGGTTTATCACTGATCCGCCGCTGGCGCAGCCACGACGTGTCGCTGCCGGTGCTGGTGCTGACCGCC
CGCGAAGGATGGCAGGATAAAGTGGAAGTGCTGAGCGCCGGGGCGGATGATTACGTCACCAAGCCTTTCCATATTGAAGA
GGTTGCCGCCCGCATGCAGGCGCTGCTGCGCCGTAACAGCGGTCTGGCCTCGCAGGTGATCTCCCTGCCGCCGTTCCAGG
TCGACCTCTCCCGGCGCGAGCTGTCGGTGAATGACCAGCCGATCAAGCTGACCGCCTTTGAATACACCATTATGGAAACC
CTGATCCGTAACCGCGGCAAAGTGGTCAGCAAAGATTCGCTGATGCTCCAGCTTTACCCGGATGCCGAACTGCGAGAAAG
CCACACCATCGACGTGCTGATGGGTCGGCTGCGCAAGAAAATTCAGGCTGAATACCCACAGGACGTCATCACCACGGTGC
GCGGCCAGGGCTATCTGTTCGAATTGCGCTGA