Detailed information of regulator


Summary

Regulator ID REG0330 experimental
Regulator type protein
Regulatory pathway (from literatures) TCS-RR
KEGG pathway (determined by BlastKOALA) Two-component system (map02020); Biofilm formation - Vibrio cholerae (map05111); Biofilm formation - Pseudomonas aeruginosa (map02025); Biofilm formation - Escherichia coli (map02026)
Related T6SS T6SS01266 insolico (Type i1); T6SS01267 insolico (Type i3)
Strain Pseudomonas chlororaphis subsp. aureofaciens 30-84
Replicon chromosome
Sequence Protein sequence (918 a.a.); Nucleotide sequence (2754 bp)
Description Transcripts of genes potentially involved in type VI secretion system, signal transduction, and carbon storage are in lower abundance in the gacA mutant relative to WT.
Reference

External database links

Locus tag (Gene) Pchl3084_4333 (gacS)
Coordinates (Strand) 5113748..5116501 (+)
NCBI ID 496335944
RefSeq NZ_CM001559
Uniprot ID UPI00000BDC9E
KEGG ID -
KEGG pathway (determined by BlastKOALA) map02020; map05111; map02025; map02026
PDB ID -

  Target
Target Regulation (↓/↑) Target sequence
Pchl3084_3491 (gacA) -

Pfam domain hit(s) of regulator

Domain Pfam ID E-value Aligned region
Response_reg PF00072.26 7.7e-28 669..783
HATPase_c PF02518.28 1.3e-27 396..511
HisKA PF00512.27 6.6e-22 285..349
sCache_4 PF09984.11 8e-16 36..168
HAMP PF00672.27 8.4e-10 190..240
Hpt PF01627.25 1.2e-09 830..910

Transmembrane helices

  • Transmembrane helices are predicted using TMHMM 2.0 software.

Prediction                 Region     Sequence
Outside 1-9 VLKKLGIKG
Transmembrane helix 10-32 RVLLLTLLPTSLMALVLGGYFTW
Inside 33-168 MQQSDLQTQLLQRGEMIAEQLAPLVAPALAHKNIALLERIATQSLEQQDVRAVTFLAPDRTPLAHAGPSMLNQAPTGNGSQMLQRTGSDATRYLLPVFGRHRNLAGDLIPDESDRLLGWVELELSHNSMLLRGYRS
Transmembrane helix 169-188 LFASLLLIIAGLICTGLLAL
Outside 189-917 RMGRTINNPLSQIKHAVTQLKDGNLETRLPLLGSQELDELASGINRMAGTLQNAQEELQHSIDQATEDVRQNLETIEIQNIELDLARKEALEASRIKSEFLANMSHEIRTPLNGILGFTHLLQKSELTPRQLDYLGTIEKSADSLLGIINEILDFSKIEAGKLVLDSIPFNLRDLLQDTLTILAPAAHAKQLELVSLVYRDTPLSLVGDPLRLKQILTNLVSNAIKFTREGTIVARAMLEEEHEDSVQLRISIQDTGIGLSNQDVRALFQAFSQADNSLSRQPGGTGLGLVISKRLIEQMGGEIGVDSTPGEGSEFWISLRLPKTRDDAEDLPAPPLLGRRIAVLENHELARQALQHQLEDCGLEVTPFNTLEALTNGVTGVHQTEQAIDLAVLGITSNDMPPERLNQHIWDLEHLGCKVLVLCPTTEQTLFHLSVPNPHSQLQAKPACTRKLRRALADLVNPKVVRNEPSEPIASRPPRVLCVDDNPANLLLVQTLLEDMGAKVLAVDSGYAAVKAVQNESFDLVMMDVQMPGMDGRQSTEAIRQWESERNCTPLPVIALTAHAMANEKRALLQSGMDDYLTKPISERQLAQVVLKWTGLALRNQGPERTGEPSGNGLELQVLDHDEGLRLAAGKADLAADMLAMLLASLEADREAIRAARAANDHNALIERVHRLHGATRYCGVPQLRAACQRSETLLKQEDVKAFAALDELERAINRLATEARINA



Signal peptides
  • Sec/SPI: "standard" secretory signal peptides transported by the Sec translocon and cleaved by Signal Peptidase I (Lep).
  • Sec/SPII: lipoprotein signal peptides transported by the Sec translocon and cleaved by Signal Peptidase II (Lsp).
  • Tat/SPI: Tat signal peptides transported by the Tat translocon and cleaved by Signal Peptidase I (Lep).
Prediction        Probability Cleavage site Signal peptide sequence
Other 0.9604 - -



  Protein sequence of regulator: 918 a.a.    .

>REG0330 NZ_CM001559:5113748-5116501 [Pseudomonas chlororaphis subsp. aureofaciens 30-84]
VLKKLGIKGRVLLLTLLPTSLMALVLGGYFTWMQQSDLQTQLLQRGEMIAEQLAPLVAPALAHKNIALLERIATQSLEQQ
DVRAVTFLAPDRTPLAHAGPSMLNQAPTGNGSQMLQRTGSDATRYLLPVFGRHRNLAGDLIPDESDRLLGWVELELSHNS
MLLRGYRSLFASLLLIIAGLICTGLLALRMGRTINNPLSQIKHAVTQLKDGNLETRLPLLGSQELDELASGINRMAGTLQ
NAQEELQHSIDQATEDVRQNLETIEIQNIELDLARKEALEASRIKSEFLANMSHEIRTPLNGILGFTHLLQKSELTPRQL
DYLGTIEKSADSLLGIINEILDFSKIEAGKLVLDSIPFNLRDLLQDTLTILAPAAHAKQLELVSLVYRDTPLSLVGDPLR
LKQILTNLVSNAIKFTREGTIVARAMLEEEHEDSVQLRISIQDTGIGLSNQDVRALFQAFSQADNSLSRQPGGTGLGLVI
SKRLIEQMGGEIGVDSTPGEGSEFWISLRLPKTRDDAEDLPAPPLLGRRIAVLENHELARQALQHQLEDCGLEVTPFNTL
EALTNGVTGVHQTEQAIDLAVLGITSNDMPPERLNQHIWDLEHLGCKVLVLCPTTEQTLFHLSVPNPHSQLQAKPACTRK
LRRALADLVNPKVVRNEPSEPIASRPPRVLCVDDNPANLLLVQTLLEDMGAKVLAVDSGYAAVKAVQNESFDLVMMDVQM
PGMDGRQSTEAIRQWESERNCTPLPVIALTAHAMANEKRALLQSGMDDYLTKPISERQLAQVVLKWTGLALRNQGPERTG
EPSGNGLELQVLDHDEGLRLAAGKADLAADMLAMLLASLEADREAIRAARAANDHNALIERVHRLHGATRYCGVPQLRAA
CQRSETLLKQEDVKAFAALDELERAINRLATEARINA*

  Nucleotide sequence of regulator: 2754 bp    .

>REG0330 NZ_CM001559:5113748-5116501 [Pseudomonas chlororaphis subsp. aureofaciens 30-84]
GTGCTTAAGAAACTGGGGATCAAAGGCCGCGTGCTGTTACTGACCTTGCTGCCAACCAGCCTGATGGCGTTGGTGCTGGG
CGGTTATTTCACCTGGATGCAGCAGTCGGACCTGCAAACCCAGCTTCTGCAACGCGGCGAAATGATCGCCGAGCAACTGG
CGCCCCTGGTGGCACCGGCCCTGGCCCACAAGAACATCGCCCTGCTGGAACGCATCGCCACCCAGTCCCTGGAACAGCAG
GACGTGCGCGCAGTGACCTTCCTCGCGCCCGACCGCACGCCCCTGGCTCATGCCGGCCCGAGCATGCTCAATCAGGCGCC
GACCGGTAACGGCAGCCAGATGCTGCAACGCACCGGCAGCGACGCCACCCGCTATCTGCTGCCGGTGTTCGGCCGCCACC
GCAACCTGGCCGGCGACCTGATTCCCGACGAGTCCGACCGCCTGCTCGGCTGGGTCGAGCTGGAGCTGTCCCATAACAGC
ATGCTGTTGCGCGGCTACCGCAGCCTGTTCGCCAGCCTGCTGCTGATTATCGCCGGGCTGATCTGCACCGGCCTGCTGGC
GCTGCGCATGGGGCGCACCATCAACAACCCGCTGAGCCAGATCAAACATGCCGTTACCCAACTCAAGGACGGCAACCTGG
AAACCCGACTGCCCTTGCTCGGCAGCCAGGAGCTGGACGAACTGGCCTCGGGCATCAACCGCATGGCCGGCACCCTGCAG
AACGCCCAGGAAGAATTGCAACACAGCATCGACCAGGCCACCGAGGACGTCCGGCAAAACCTGGAAACCATCGAGATCCA
GAACATCGAACTGGACCTGGCGCGCAAGGAGGCCCTGGAGGCCAGCCGCATCAAGTCGGAATTCCTGGCCAACATGAGTC
ACGAAATCCGCACGCCGCTCAACGGTATTCTCGGTTTCACCCACCTGTTGCAGAAAAGCGAACTGACCCCGCGCCAGCTG
GATTACCTGGGCACCATCGAAAAGTCCGCCGACAGCCTGCTGGGAATCATCAACGAAATTCTCGATTTCTCGAAAATCGA
AGCCGGCAAGCTGGTGCTCGACAGCATTCCGTTCAACCTGCGCGACCTGTTGCAGGACACCCTGACCATCCTCGCCCCGG
CCGCCCACGCCAAGCAGCTGGAACTGGTCAGCCTGGTGTATCGCGATACTCCGCTGTCGCTGGTGGGCGACCCGCTGCGT
CTCAAGCAGATCCTCACCAACCTGGTGAGCAACGCCATCAAGTTCACCCGCGAAGGCACCATCGTCGCCCGCGCCATGCT
CGAAGAAGAACACGAAGACAGCGTGCAACTGCGCATCAGCATTCAGGACACCGGCATCGGCCTGTCGAACCAGGACGTGC
GCGCCCTGTTCCAGGCCTTCAGCCAGGCCGACAACTCGTTGTCGCGGCAACCGGGCGGTACCGGCCTGGGGCTGGTGATC
TCCAAGCGCCTGATCGAACAGATGGGTGGCGAGATCGGCGTCGACAGTACGCCCGGCGAAGGTTCGGAGTTCTGGATCAG
CCTGCGCCTGCCGAAAACCCGCGACGACGCCGAAGACCTGCCCGCCCCGCCGCTGCTCGGCAGGCGGATCGCGGTCCTGG
AGAACCATGAGCTGGCGCGCCAGGCCCTGCAGCACCAACTCGAGGACTGCGGTCTGGAAGTGACGCCGTTCAATACCCTG
GAAGCCCTGACCAACGGCGTGACCGGAGTGCACCAGACCGAACAGGCGATCGATCTGGCGGTGCTCGGCATCACCAGCAA
TGACATGCCGCCGGAACGCCTCAACCAGCACATCTGGGACCTCGAACACCTGGGCTGCAAAGTGCTGGTGCTGTGCCCGA
CCACCGAACAGACGCTCTTCCATCTTTCGGTGCCCAACCCTCACAGCCAGTTACAGGCCAAACCAGCCTGCACCCGCAAA
CTGCGACGCGCCCTGGCCGACCTGGTCAACCCCAAGGTGGTGCGCAACGAGCCGAGCGAACCGATCGCCAGTCGCCCGCC
ACGGGTGCTGTGTGTCGATGACAACCCGGCCAACCTGCTGCTGGTGCAGACCCTGCTCGAAGACATGGGCGCCAAGGTGC
TCGCGGTGGACAGCGGCTATGCGGCGGTCAAGGCGGTGCAGAATGAATCGTTCGACCTGGTGATGATGGACGTGCAGATG
CCCGGCATGGACGGCCGCCAGAGCACCGAGGCGATTCGCCAGTGGGAGAGCGAACGCAACTGCACGCCGCTGCCGGTGAT
CGCCCTCACCGCCCACGCCATGGCCAACGAAAAACGCGCGCTGCTGCAAAGCGGCATGGACGACTACCTGACCAAGCCCA
TCAGTGAGCGGCAACTGGCTCAGGTGGTGCTGAAGTGGACCGGTCTGGCCCTGCGCAACCAGGGACCGGAACGCACTGGC
GAACCGTCCGGCAACGGCCTCGAGCTGCAAGTGCTGGATCACGACGAAGGTTTGCGCCTGGCCGCCGGCAAGGCGGACCT
GGCCGCCGACATGCTGGCGATGCTCCTGGCCTCGCTGGAGGCCGACCGTGAAGCGATTCGCGCCGCCCGTGCCGCCAACG
ACCACAATGCGCTGATCGAACGGGTCCACCGTCTGCACGGGGCCACCCGCTACTGTGGCGTGCCACAGTTGCGCGCCGCC
TGCCAGCGCAGCGAAACCCTGCTCAAGCAGGAAGACGTCAAGGCCTTCGCCGCCCTCGACGAACTCGAACGGGCCATCAA
CCGCCTGGCCACGGAGGCCCGCATCAACGCCTGA